(data stored in ACNUC7421 zone)

EMBL: CP001389.PE5

CP001389.PE5         Location/Qualifiers
FT   CDS_pept        4024..4887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00050"
FT                   /product="putative glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23809"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI6"
FT                   /protein_id="ACP23809.1"
FT                   /translation="MSTNARTASVADIRAAIEDWAGALRRKDAGRVLSHGTQDCVIYSL
FT                   APPLKASDADPGGLEQWFSTWKGPLGYQLQDLEISSGGDIAFATALAHLSGEKQDGAKV
FT                   SLWYRLTLGLERTDKGWKIAHQHESVPFYMDGSFKAAIDLDPTSQVDWNAPSHPPMAGV
FT                   IAYLNVENADATAKFYGRAFGAREEDRKYAEDGKRLIHCHLTINGGALMLNDPFPEFGF
FT                   PWKPPEGFVLHLIVDDAHAWWERAVAAGAEATMPLEIAFWGDYYGQLRDPFGITWGIVA
FT                   PVKKSN"
     atgtccacca acgcgaggac agcaagcgtc gccgatattc gggcggcaat cgaagattgg        60
     gcgggggccc tgcggcggaa ggatgctggc cgtgtccttt cgcatggcac gcaggattgc       120
     gtcatctact cgctggcacc gccgctgaag gcctcggacg ccgaccccgg cggcctggaa       180
     cagtggtttt ccacctggaa ggggccgctc ggctaccagc ttcaggacct cgagatttca       240
     tccggcgggg acatcgcctt cgccacggcg ctggcgcatc tctccggcga gaagcaggat       300
     ggtgcgaagg tatcgctctg gtaccggctg acgctgggcc tcgaacgcac cgacaaggga       360
     tggaagatcg cccaccagca cgagtcggtc cccttctata tggacggaag cttcaaggcg       420
     gcgatcgatc tcgacccgac gtcgcaggtc gactggaatg cgccctcgca tccgccgatg       480
     gccggcgtca tcgcctatct caacgtcgaa aatgcggatg cgaccgccaa gttctacggc       540
     cgcgcctttg gcgccaggga ggaggaccgc aaatatgctg aggacggcaa gcgcctgatc       600
     cattgccacc tgacgatcaa cggcggcgcg ctaatgctga acgacccctt cccggaattc       660
     ggctttccct ggaagccgcc ggagggcttc gtcctgcatc tcatcgtcga cgacgcccat       720
     gcctggtggg aacgggcggt cgcggccggt gcggaggcga cgatgccgct ggagatcgcc       780
     ttctggggcg actattacgg ccagctccgc gatccgttcg gcatcacctg gggcattgtc       840
     gcgcctgtga agaagagcaa ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page