(data stored in ACNUC7421 zone)

EMBL: CP001389.PE50

CP001389.PE50        Location/Qualifiers
FT   CDS_pept        complement(53075..53332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23854"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF17"
FT                   /protein_id="ACP23854.1"
FT                   /translation="MGLKTITSSLSKNDLAHLGAGEVGYIRKMRSEEVSRCFPEAPEMG
FT                   PGIDLWALFAADGTPILLTDNRSSTFFKAAEDDLRTVSLH"
     atgggactga aaaccatcac ctcatcgctg tcgaagaacg accttgcgca tctcggcgcg        60
     ggcgaagtcg gctatatccg caagatgcga tcggaggaag tctcccgctg cttcccggaa       120
     gctcccgaga tggggccggg catcgatctc tgggccctgt ttgcggcgga cggcacgccg       180
     atccttttga ccgacaaccg ctcgagcacc ttcttcaagg ccgccgagga cgacctgcgc       240
     accgtcagcc tgcattga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page