(data stored in ACNUC7421 zone)

EMBL: CP001389.PE500

CP001389.PE500       Location/Qualifiers
FT   CDS_pept        564606..566021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05080"
FT                   /product="Zn-dependent protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24304"
FT                   /db_xref="GOA:C3MHH6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH6"
FT                   /protein_id="ACP24304.1"
FT                   /translation="MDTNLISLFDADEATVRKVLSETLAGADDGELFLEHAQAEVLSFD
FT                   NGRLKGGSFNTDQGFGLRAVAGEAVGYAHAGEVSLAALKRAADAVGQVTRGYSGSYAAA
FT                   PQRTNKKLYGDENPIGEPRFETKVTLLQEIDAYLRAKEPKVRQVTATVATSWQVVDILR
FT                   ADGHRVHDVRPMTRINISVVVGEGDRQESGTFGIGGRRGFGDFITEENWKRGADEALRQ
FT                   ALVNLEAVDAPAGTMDVVLASGWPGVMLHEAVGHGLEGDFNRKKTSAFAGLLGEQVAAK
FT                   GVTVVDDGTIEARRGSISIDDEGTPSGYNVLIEDGKLVGYMQDRQNARLMGMQPTGNGR
FT                   RQGYAHVPMPRMTNTYMLAGDRTPEEIIASVKKGIYAVSFGGGQVDITSGKFVFGCTEA
FT                   YLIEDGKVGAPAKGAMLIGNGPDAMRRVTMVGNDMKLDTGIGNCGKGGQWVPVGVGQPH
FT                   LRMDQITVGGTQA"
     atggacacca acctcataag cctcttcgat gcggacgagg cgacggtccg caaggttctc        60
     tccgagacgc tggccggcgc cgacgatggc gagctcttcc ttgaacacgc ccaggcggaa       120
     gtgctctcct tcgacaatgg ccgtctcaag ggcggcagct tcaacaccga ccagggcttc       180
     ggcctgcgcg ccgtcgccgg cgaagcggtc gggtacgccc atgccgggga agtgtcgctt       240
     gccgccctga agagggcggc ggacgccgtc ggacaggtga cccgcggcta ttccggctcc       300
     tatgcggctg ccccgcagcg caccaacaag aagctttacg gtgatgaaaa cccgatcggc       360
     gagccgcgct tcgagacgaa ggtgacgctg ctccaggaga tcgatgccta tctgcgcgcc       420
     aaggagccca aggtcaggca ggtgacggcg acggtcgcga caagctggca ggtcgtcgac       480
     attctaaggg cggatggaca tcgtgttcat gacgtgcggc cgatgacgcg catcaatatc       540
     tcggtcgtgg tgggggaggg cgatcggcag gaatccggca cattcggtat cggcggacgg       600
     cgcgggttcg gcgattttat caccgaggaa aactggaagc gcggtgccga cgaagcgctg       660
     cggcaggcgc tcgtcaatct tgaggcagtc gacgcgccgg cgggaaccat ggacgtggtg       720
     cttgcttccg gctggccggg ggtgatgctg catgaagcgg tcggccacgg cctggaaggc       780
     gacttcaacc ggaagaaaac ctccgccttc gccgggctcc tcggcgagca ggtggcggcc       840
     aagggcgtca cggtcgtcga cgacggcacg atcgaggcgc ggcgcggctc gatctcgatc       900
     gacgacgagg gcacgccctc cggctacaac gtcctgatcg aggacggcaa gcttgtcggc       960
     tatatgcagg accggcagaa cgcgcggctg atgggcatgc agccgaccgg caacgggcgc      1020
     cgccagggct atgcgcatgt gcccatgccg cgcatgacca acacctacat gcttgccggc      1080
     gaccggacgc ccgaggaaat catcgcctcg gtgaagaaag gcatctatgc cgtttcgttc      1140
     ggcggcggcc aggtggatat cacgtcaggc aagttcgtgt tcggttgtac cgaagcctat      1200
     ctgatcgagg acggcaaggt cggcgcgccg gccaaggggg cgatgctgat cggcaatggg      1260
     ccggatgcga tgaggcgggt gacgatggtc ggcaacgaca tgaagctcga caccggcatc      1320
     ggcaattgcg gcaagggagg ccaatgggtg cctgtcggcg tcggtcagcc gcatctgcgg      1380
     atggatcaga tcaccgtcgg tggcacgcag gcatag                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page