(data stored in ACNUC7421 zone)

EMBL: CP001389.PE503

CP001389.PE503       Location/Qualifiers
FT   CDS_pept        567218..568600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05110"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-20f"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24307"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C3M906"
FT                   /protein_id="ACP24307.1"
FT                   /translation="MQTHCIAEQLEFEGFDGHKVVAGFDGGAITSDAGALLLRHVDGVI
FT                   GLFDRVAACFVDDRDPTCTVHSVRTLVGQRVAAIALGYEDVDDHDRLRHDPVLALLSER
FT                   LTPKRQDCAVLAGKSTLNRLEHGRLGQPTRYHKIAYDRQALEALFIELFLDAHDSPPEE
FT                   IVLDLDATDDPLHGHQEGRFFHGYYNCYCYLPLYIFCGRHLLSAKLRRSNIDASAGSVA
FT                   EIDRIIGQIRQSWPNVRIILRADSGFARDELMDWCETNKVDYVFGLARNPRLERQIAPA
FT                   MEEASLLSQASAQATRVFRDFLWSTKDSWTRRRRVVGKAEWTLLGANPRFIVTSLKPER
FT                   WAAQTLYEDLYCARGDMENRIKECQLDLYADRTSAHTMHANQLRLWFASLAYVLICALR
FT                   RLGLAHTRLAEATCGTIRLKLLKIGAQVRVSVRRIKIAMASACPYADEFALAHARIRAA
FT                   AR"
     atgcaaacac actgtatcgc cgagcagctc gaatttgaag gcttcgacgg tcacaaagtg        60
     gtcgctggtt tcgacggcgg agcgatcacc tcggatgccg gcgccctgct gcttcgccat       120
     gtcgatgggg tcatcggact gttcgaccgg gtggccgctt gcttcgttga tgaccgcgat       180
     ccgacgtgca cggtccacag cgtgcgcacg ctggtcgggc agcgcgttgc ggcgatcgcg       240
     ctgggctacg aggatgtcga tgaccacgac aggctgcgcc acgacccggt gctcgcgctt       300
     ctgtcggagc ggctgacgcc gaagcggcaa gactgtgcgg tgcttgccgg caaatccacc       360
     ttgaaccggc tggagcacgg ccgtctcggc cagccgacgc gctatcacaa gatcgcttac       420
     gacaggcaag cgctggaagc gctgttcatc gagctgttcc tggacgcgca cgacagcccg       480
     cctgaggaaa tcgtgctcga tctcgacgcc accgatgatc cgctgcacgg tcaccaggag       540
     ggtcggttct ttcacggcta ttacaactgc tattgctatc tgccgctgta catcttctgc       600
     ggccgccacc tgctttcggc caagctacgg cgttcgaaca tcgacgccag cgcaggctcg       660
     gtcgccgaaa tcgatcgtat catcgggcag atccgccaaa gctggccaaa cgtgcgcatc       720
     atcctgcgcg ccgattccgg cttcgcccgc gacgaactga tggactggtg cgagaccaac       780
     aaggtcgact atgtctttgg ccttgctcgc aacccgcggc tggaaaggca aatcgcgccg       840
     gccatggagg aagcaagcct gttatcccag gcaagcgccc aggcgacccg cgtcttccgc       900
     gacttcctgt ggtcgaccaa ggacagctgg acacgacgac ggcgggtcgt tggaaaagcg       960
     gaatggacgc tgctgggcgc caatccgcgc ttcatcgtca cctcccttaa gccagagcgc      1020
     tgggcggcac agacgcttta cgaggatctc tactgcgccc gcggtgacat ggagaaccgc      1080
     atcaaagaat gccagctcga tctctacgcc gaccgcacca gcgcccacac catgcacgcc      1140
     aatcaactgc gcctctggtt cgcctcgttg gcctacgtgc tgatctgcgc cctgcgccgc      1200
     cttggccttg cccatacgcg gctcgccgag gcgacctgcg gcaccatccg gctgaagctg      1260
     ttaaagatcg gcgcccaggt ccgcgtctcg gtgcgtcgca tcaaaatcgc gatggcatcc      1320
     gcctgtccct atgccgacga atttgcactg gcacacgccc gaatacgtgc cgcggcccgc      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page