(data stored in ACNUC7421 zone)

EMBL: CP001389.PE505

CP001389.PE505       Location/Qualifiers
FT   CDS_pept        570265..571377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05130"
FT                   /product="putative polysaccharide deacetylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24309"
FT                   /db_xref="GOA:C3MHI1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI1"
FT                   /protein_id="ACP24309.1"
FT                   /translation="MRHSLATMVRNHLRRAAIAGGLEAANALARLGLMAESRGRGAIFT
FT                   LHHVRPKGHRDFDPNGHLEITPAFLEKTILTLKRAGYRFAALDELPEWLAATDERPVAC
FT                   FTLDDGYRNNLEWAQPVFERHGVPFTVFVTAGYVDRTHTLWWETLADLLSARHEFRFDF
FT                   GDGAVLVSSGSSVQKQAAFDRIAAYIHGADEARAVAVLNCAALEHGIDPIAITEHLTLD
FT                   ESGLRALIANPLASLGAHTISHRALARLNDDEARREITSSAARVEAITGRRPLTIAYPY
FT                   GFRPTVSARDHRLAADLGFTVAVTTEPGTLSSGVNRHAVPRISLNGHFQSERYVSALAS
FT                   GIPFRLLHDSLNRNRFKDKIMQQFEALQRP"
     atgagacact cgctcgcgac gatggtccgg aaccatttga ggcgggccgc cattgccggc        60
     gggctcgagg ccgcaaatgc gcttgcgcgt ctggggctga tggcagaatc gcgcggccgc       120
     ggcgccatct ttaccctgca tcatgtccgc cccaagggcc atcgggactt cgatcccaac       180
     gggcatctgg agatcacccc ggcattcctc gagaaaacca tcctgacgtt gaaacgcgcc       240
     ggctaccgct ttgctgctct cgacgagttg ccggaatggc tggcagcgac cgacgagcgg       300
     ccggtcgcct gcttcaccct ggacgacggc tatcgcaaca atctcgaatg ggcgcagccc       360
     gtattcgaga gacacggcgt tccgttcacc gtcttcgtca cggccggcta tgtcgatcgc       420
     acccacacgc tgtggtggga aacgcttgcc gatttgctgt ccgcccgcca cgagttccgc       480
     ttcgacttcg gagacggtgc ggtattggtc tcaagcggca gttccgtgca gaagcaggct       540
     gccttcgatc gcatcgctgc ctatatccat ggcgcagatg aggcccgcgc cgtggcggtt       600
     ctcaactgtg ccgcattgga gcatggcatc gatcccatcg ccatcaccga gcatctgacg       660
     ctcgatgaaa gcggtctccg cgccttgatc gcaaacccgc tcgccagtct cggtgcgcac       720
     acgatcagtc atcgggcgct ggcgcggctc aatgacgacg aggcccgccg ggaaatcacc       780
     tcatccgccg cacgcgtcga ggcgattacc ggaaggcggc cgctcaccat cgcctatccc       840
     tatggcttcc ggccgacggt ctcggcccgt gaccatcggc tggccgcgga tctcggcttt       900
     accgttgcgg tcacaacaga accggggacg ctttcttctg gcgtcaatcg tcacgccgtg       960
     ccccgcattt cgctgaacgg ccatttccag agcgagcgtt atgtgtccgc cctggcctcc      1020
     ggcataccgt tccgtctact gcatgattcc ttaaatcgga atcgatttaa ggacaaaatc      1080
     atgcagcagt tcgaagcgct acagcgccct tag                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page