(data stored in ACNUC7421 zone)

EMBL: CP001389.PE507

CP001389.PE507       Location/Qualifiers
FT   CDS_pept        572195..572647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24311"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI3"
FT                   /protein_id="ACP24311.1"
FT                   /translation="MQDIAKWIDGKKGFSFALLRSAALCLTVVALPGCMGGGLDLFGSS
FT                   SVDRSVATGTVPVAKTSDGLSDAVTVRNAVSSAEITEGGSAIPWANATSGSAGVISSIE
FT                   EDHASGVLCRRFTTTRHSFEGIAKFDGRTCRLDNGEWYLTSFGPQG"
     gtgcaagaca tagcaaagtg gatcgatggc aagaagggtt tttcctttgc gttgctgcgc        60
     agcgcggctc tatgcctgac tgtcgtcgcg cttccaggct gcatgggcgg cggtctcgat       120
     ctgttcggaa gctcgagcgt cgatcgctcg gtcgcgaccg ggaccgtacc ggtcgccaag       180
     acgtccgacg gcctctccga tgcagtcacc gtgcgcaatg ccgtttcttc ggccgaaatc       240
     actgagggcg gcagcgccat tccgtgggcc aatgccacgt ccggcagcgc cggcgtcatc       300
     agcagcatcg aggaagacca cgcttccggg gtgctttgcc gccgcttcac caccacgcgc       360
     cactccttcg aaggcatcgc caaattcgac ggcaggacgt gccggctcga caatggcgaa       420
     tggtatctga cgagcttcgg cccgcagggc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page