(data stored in ACNUC7421 zone)

EMBL: CP001389.PE511

CP001389.PE511       Location/Qualifiers
FT   CDS_pept        complement(575702..575962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24315"
FT                   /db_xref="InterPro:IPR009780"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI7"
FT                   /protein_id="ACP24315.1"
FT                   /translation="MRFVIATLMATASLLSPLSVHAESADVEAVITNIDTEQLSLSLDD
FT                   GKSYQAPEEFNFEGLEAGVKVLVFYTEVDGKRVINDLEIVQ"
     atgcgatttg tcattgcgac gctcatggct accgcaagct tgctttcgcc cctctcggtc        60
     cacgccgaaa gcgccgacgt cgaggccgtg atcaccaaca tcgacacaga gcaactgagc       120
     ctctcgctcg acgacggcaa gagctaccag gcacccgagg aattcaactt cgaagggctg       180
     gaggccggcg tcaaggtcct cgtcttctac accgaagtcg atggcaagcg cgtcatcaac       240
     gacctggaga tcgtccagta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page