(data stored in ACNUC7421 zone)

EMBL: CP001389.PE522

CP001389.PE522       Location/Qualifiers
FT   CDS_pept        585621..586004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24326"
FT                   /db_xref="GOA:C3MHJ8"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ8"
FT                   /protein_id="ACP24326.1"
FT                   /translation="MNDDKALYPPVDPIVAGIKGLCPRCGQGHVFDGFLKVRPACENCE
FT                   LDYRFADSGDGPVVFVILIVGFIVVGAALWMEVNLNPPLWLHFLLWIPLATVFSLVLTR
FT                   MLKGVLINLQYRNNARSGEIDRG"
     atgaatgacg acaaggcgct ctacccgccg gttgacccga tcgtggcggg aatcaaggga        60
     ctttgcccgc gctgtggcca gggccatgtt ttcgacggct tcctgaaggt tcggccggct       120
     tgcgagaatt gcgaactcga ctatcgcttt gccgattccg gcgatggccc cgtcgttttc       180
     gtcatcctca tcgtcggctt catcgtcgtt ggggcggcgc tgtggatgga ggtcaacctc       240
     aatccgccgc tatggctgca cttcctgctc tggataccct tggcgacggt atttagcctt       300
     gtcctgacga ggatgttgaa gggcgtgctg atcaatctgc agtatcgcaa caatgcgcgt       360
     tcgggcgaaa ttgaccgtgg ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page