(data stored in ACNUC7421 zone)

EMBL: CP001389.PE528

CP001389.PE528       Location/Qualifiers
FT   CDS_pept        590015..590965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05360"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-21a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24332"
FT                   /db_xref="GOA:C3MHK4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK4"
FT                   /protein_id="ACP24332.1"
FT                   /translation="MSNISMICAGIDVAKDRLEVAVHPGGARLDVGNDAAGLQALDAFL
FT                   DTHGVQRVGFEASGGYEWRLMAHLRQGPRPAARLQPAQVRAFAKSRLQRAKNDRLDARL
FT                   IAAFTAALERLPELPEARFDNLAAELTYLEQIEQQIALVKTFAEAALTDSIRRRHQRQI
FT                   ETLTKKREAEIERIAKAMRADAQLSRRLDLLVSIKGIGLRSALALVIRLPELGQASREE
FT                   VAALVGVAPFDDDTGKRCGIRHIDGGRERLRKAVFMCAFTAARHNPDLAAFYKRLRQKG
FT                   KDHKLAVIAVARKLVVLANAVVARGSEWTPRYQHP"
     atgagcaata ttagcatgat ctgtgccgga atcgatgttg ccaaggaccg cctcgaggtc        60
     gccgtccatc ccggcggggc gcggctcgat gtcggtaatg acgcggccgg gctccaggcc       120
     ctcgacgcct ttctcgacac ccatggtgtc cagcgcgtcg gcttcgaggc ttccggcggt       180
     tatgagtggc ggctgatggc gcacctgcgc caagggccgc ggccggccgc ccggctgcag       240
     ccggcgcagg tgcgcgcctt cgccaaaagc cggctgcagc gggccaagaa cgatcgcctc       300
     gatgcgcggt tgatcgccgc tttcaccgcc gcgctggagc ggctgccgga gctgccggag       360
     gcccggttcg acaacctcgc cgccgaactg acctatctgg agcagatcga gcagcagatc       420
     gctctggtca agacttttgc cgaggcggcc ctgaccgaca gcatccggcg ccgccatcag       480
     cggcagatcg aaacgctcac caagaaacgc gaggccgaga tcgaacgcat cgccaaggcg       540
     atgcgcgcgg atgcgcagct ctcccgccgg ctcgacctgc tcgtttcgat caagggcatc       600
     ggcctgcgca gcgcccttgc cctcgtcatc cgcctgcccg agctcggcca ggccagccgc       660
     gaggaagtcg ccgccctggt cggcgtcgcg ccctttgacg acgacaccgg caagcggtgc       720
     ggcatccgcc acatcgacgg cggacgcgaa cgcttgcgca aggctgtttt catgtgcgcc       780
     ttcaccgccg cccgccacaa tccggacctt gccgccttct acaagcgcct gcgccagaag       840
     ggcaaggatc ataagctcgc cgtcatcgcc gtcgcccgca agctcgtcgt cctcgccaat       900
     gccgtcgtcg cccgcggctc cgaatggaca ccgcgatatc aacatccctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page