(data stored in ACNUC7421 zone)

EMBL: CP001389.PE529

CP001389.PE529       Location/Qualifiers
FT   CDS_pept        complement(591088..591573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05370"
FT                   /product="peroxiredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24333"
FT                   /db_xref="GOA:C3MHK5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK5"
FT                   /protein_id="ACP24333.1"
FT                   /translation="MTIAVGDKLPNATFKEKTADGPVEVTTDQLFKGKRVVLFAVPGAF
FT                   TPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDLHVMGAWATSSGGMGKIHFLSDWNA
FT                   AFTKALGLDIDLSAGTLGIRSKRYSMLVEDGVVKALNVEDAPGQATVSGAAAMLEQL"
     gtgaccatcg ctgtcggaga caagctgccc aacgcaacct tcaaggaaaa gaccgccgac        60
     ggcccggtcg aggtgaccac cgaccagctc ttcaagggca agcgcgtcgt ccttttcgcc       120
     gtgccggggg cgttcacccc gacgtgctcg ctcaaccatc ttcccggcta tctcgaaaac       180
     cgcgatgcga tcctggcgcg cggcgtcgac gacatcgccg tggtcgccgt caacgacctg       240
     catgtgatgg gcgcctgggc aacctcgtcg ggcggcatgg gcaagatcca tttcctgtcg       300
     gattggaacg ctgccttcac caaggcgctt ggcctggaca tcgatctgtc ggccggaacg       360
     ctcggcatcc gctcgaagcg ctattcgatg ctggtcgagg acggcgtggt caaggcgctg       420
     aatgtcgaag acgcgcccgg tcaggcgacg gtatcgggcg cggcggcgat gttggagcag       480
     ctttga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page