(data stored in ACNUC7421 zone)

EMBL: CP001389.PE53

CP001389.PE53        Location/Qualifiers
FT   CDS_pept        complement(55146..57521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00530"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23857"
FT                   /db_xref="GOA:C3MF20"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF20"
FT                   /protein_id="ACP23857.1"
FT                   /translation="MREDFMFNFHAKSLATKLIAVTGGTIALVLLASNFVLISQTQDRV
FT                   ETLVFDGAKTEARAIAADIAGSVGELAAAARTMSGVLGRGHAGKSTDRAGAINLLKANL
FT                   DQHDFAFGSWFAEEPKAFDGRDVVNNTELGGNAEGAFTPYWSKDRNGKAKLSTFRADYA
FT                   AEWYSLAAKSGKGAITQPYLAEGTDVPTTMTSIAYPVMSDGKMIGVSGADISLASLADR
FT                   LATLKPFGSGRVYLLSQGGKWLAAPIPDLLMKDYEGEGADVIKNALSSDASGMIKNLTY
FT                   DGNEPFDRVVYPFKLPDVNASWVILVDVPRTAINAPVNDQTYMMIIGGIVVLGAVLAGL
FT                   YLAVRRFVQKPLAGLVHDVETLSNGDYARPISGQDRLDETGSVAKALEGFRHQLADTKR
FT                   LEGEARHEREQAERERSRSESERAETGALQRDIVARLGKGLSHLASGDLAYRIADEFPG
FT                   EYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTGEISSAANDLSHRTEQQAASLEETA
FT                   AALDELTSQVDASAENAKVAAKSVELASSDAAQSGEVVQKAIAAMQGIEQSSNEVSRII
FT                   GVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSANAAKEIKTLINTS
FT                   AGQVREGVDLVGKTGGALKKIAEQVVQINGLIRQISGSASEQAVGLKEINAAVNQMDQV
FT                   TQQNAAMVEETTAASMTLNEEARTLSGLVARFSVAKREPAQSSADMLRSAASRMRTAEA
FT                   PRPAPEQPAARGYSTPTQRVLAQTAGGNALARDNWEEF"
     gtgcgtgagg atttcatgtt caacttccat gccaaatcgc tggccaccaa gctgatcgct        60
     gtcacgggcg gcacgatcgc tctcgtgttg ctcgcgtcga atttcgttct catctcgcag       120
     acccaggacc gtgtcgagac gctcgtcttc gacggcgcga agaccgaggc ccgtgcgatt       180
     gccgccgata tcgccggcag cgtcggagag ctggcggccg ctgcccgcac catgtcgggc       240
     gtgcttggcc gcggccatgc cgggaaatcg accgaccgtg ccggcgccat caacctgttg       300
     aaagccaatc tcgatcagca cgacttcgcc ttcggcagct ggttcgccga ggagcccaag       360
     gccttcgacg gcagggacgt cgtcaacaac accgagcttg gcggcaatgc cgaaggcgcg       420
     ttcacgccct attggtcgaa ggatcgcaac ggcaaggcaa agctctcgac cttccgtgcg       480
     gactatgcgg ccgaatggta cagccttgcc gccaagagcg gcaaaggcgc catcacccag       540
     ccttatctgg ccgaaggcac cgacgttccg acaacgatga catcgatcgc ctatcctgtc       600
     atgtccgatg gcaagatgat cggcgtctcg ggcgccgaca tctcgctcgc ctcgcttgcc       660
     gaccggctcg caacgttgaa gcccttcggc tcgggccgcg tctacctgct gtcgcagggc       720
     ggcaagtggc ttgccgcgcc gatccctgat ctcctgatga aggattatga aggcgaaggc       780
     gccgacgtca tcaagaacgc cctgtcgtcg gacgcttcag gcatgatcaa gaacctgacc       840
     tatgacggaa acgagccctt cgaccgcgtc gtctatccgt tcaagctccc cgatgtgaat       900
     gcgagctggg tcatcctcgt cgacgtgccg cgcaccgcca tcaacgcgcc cgtcaacgac       960
     cagacctata tgatgatcat cggcggcatc gtcgtcctcg gagccgtgct cgccggcctc      1020
     tatctcgccg tgcgccgctt tgtccagaag ccgctcgccg ggcttgtcca cgacgtcgag      1080
     acgctcagca atggcgacta tgccaggccg atctccgggc aggaccgctt ggacgagacc      1140
     ggttcggtcg ccaaggcgct cgaaggcttc cgtcaccagc tcgccgacac caagcgcctc      1200
     gaaggcgagg cccgccacga acgcgaacag gccgaacggg agcgcagccg ctcggaaagc      1260
     gagcgggccg aaaccggcgc gctgcagcgc gacatcgtcg cgcgcctcgg caagggtctg      1320
     tcgcatcttg cctccggcga ccttgcctac cggatcgccg acgagttccc gggcgaatac      1380
     gcccagctga agcgcgactt caacgcgacg atggagagcc tcgaggagac gatccgcacc      1440
     gtcaaccatt cggtcgtcaa tatcggcagc ggcaccggcg agatttcaag cgccgccaac      1500
     gacctctcgc accggaccga gcagcaggcc gcaagcctcg aggaaaccgc cgccgcccta      1560
     gacgagctga cgtcgcaggt cgatgccagc gccgagaatg ccaaggtcgc ggcaaagtcg      1620
     gtcgaactgg cgagcagcga cgccgcgcag tccggtgagg tcgtccaaaa ggcgattgcg      1680
     gcgatgcaag gtatcgagca atcctcgaac gaggtgagcc gcatcatcgg cgtcatcgac      1740
     gagatcgcct tccagaccaa cctgctcgcc ctcaacgcgg gtgtcgaagc cgcccgcgcc      1800
     ggcgaggccg gcaagggttt tgcggtcgtc gcgcaggagg tccgcgagct cgcccagcgc      1860
     tcggcgaacg ccgccaagga gatcaagacc ctgatcaata cctcggccgg gcaggtccgc      1920
     gagggcgtcg atctcgtcgg caagacgggc ggcgcgctca agaagatcgc cgagcaggtg      1980
     gtgcagatca acggcctcat ccgccagatc tccggttcgg cctccgagca ggccgtcggc      2040
     ctcaaggaga tcaacgcggc cgtcaaccag atggaccagg tgacgcagca gaatgccgcg      2100
     atggtcgaag agacgacggc ggccagcatg acgctgaacg aggaagcccg cacgctgagc      2160
     gggctggttg cccggttcag cgtggccaag cgggagccgg cgcagtcgtc cgccgatatg      2220
     ctgcgcagcg ccgcctccag gatgcgaacg gcagaggctc cacgccccgc gccggaacag      2280
     ccggcagcac gcggctactc gacccccacc cagcgcgttc tcgcgcagac ggccggcggc      2340
     aatgcgctcg cccgggacaa ttgggaagag ttctga                                2376
//

If you have problems or comments...

PBIL Back to PBIL home page