(data stored in ACNUC7421 zone)

EMBL: CP001389.PE531

CP001389.PE531       Location/Qualifiers
FT   CDS_pept        592735..593340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24335"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHK7"
FT                   /protein_id="ACP24335.1"
FT                   /translation="MATAVQQKIRERGFLDGQFLIAMPSMFDANFARTVIFVCAHSEDG
FT                   AMGFVLNRPQRLTFPDVLLHLQLLDPDEVIRLPSAAREFQIQAGGPVETGRGFVLHSDD
FT                   YLSDSSIPVSDDICLTATLDIVKAISRGEGPLKATMLLGYAGWGPGQLENEISSNGWLT
FT                   CPAREELIFSRDLDEKYDRALALMGISPAMLSSDAGHA"
     atggcgacag cggtgcagca aaagatacgc gaacgtggtt tccttgacgg tcagttcctg        60
     atcgccatgc ccagtatgtt cgatgccaat tttgcccgca cggtcatctt cgtctgcgcc       120
     cattcggaag acggcgcgat gggcttcgtg ctgaacagac cccagcggct gaccttcccg       180
     gacgtgctcc tgcacctgca actgctcgat cccgacgaag tgatccgact gccttcggcg       240
     gcgcgcgaat tccagattca ggctggcggc cccgtcgaga ccggccgtgg tttcgtcctg       300
     cattcggacg attacctcag cgattcaagc attccggtca gcgacgacat ctgcctcacc       360
     gcgacgctcg acatcgtcaa ggccatttcg cgcggcgagg ggcctctcaa ggccacgatg       420
     ctgctcggct atgccggatg gggaccgggg cagctcgaaa acgaaatctc cagcaacggc       480
     tggctgacgt gcccggcgcg cgaggaactg atcttcagcc gtgacctcga cgagaaatac       540
     gatcgggcgc ttgctttgat gggcatctct ccggcaatgc tgtcctctga cgccggccac       600
     gcctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page