(data stored in ACNUC7421 zone)

EMBL: CP001389.PE532

CP001389.PE532       Location/Qualifiers
FT   CDS_pept        complement(593365..596280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05400"
FT                   /product="putative diguanylate cyclase
FT                   (GGDEF)/phosphodiesterase (EAL) with PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24336"
FT                   /db_xref="GOA:C3MHK8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK8"
FT                   /protein_id="ACP24336.1"
FT                   /translation="MMPLTRKPFASSTARLAAFLVAFAVFIFGVAGGVAHALEPVKISR
FT                   EDTALDLTATTEIYSGRGEAFQVSTAPGTDGIVRRIEVRSSTEHHQGDWAVFALANVSE
FT                   EQLERVIVAPHFRLVNSKLFWPDLGSQRILSITPSEGFALDRQPSDEADVFRITLNPGA
FT                   VITFVAELATPELPQIYLWQPDAYKDTVNAFTLYRGIVLGIAGLLAVFLTILFVVKGTS
FT                   MLPATAALAWAVLAYICVDFGFLSKLISVTAGDERIWRAGTEVFLAAGLVIFLFTYLNL
FT                   NRWHQHLGYATLAWILGLALLFGVAVYDPAIASGIARLSFALTATVGIVLIAYLGFNRY
FT                   DRAILLVPAWLLILVWLFGAWLAVTGQLANDIVQPALGGGLVLIVLLIGFTVMQHAFAG
FT                   GAYQQGLFSDLERQALALTGSGDTVWDWDVARDRVVTIPDISHQLGLSLGTMNGPVRNW
FT                   VPRLHPDDRDRFRATLDVLLEHRRGRLNHEFRARAEDGHYHWLSIRARPVLGANGEIIR
FT                   CVGTIVDITEQRNSVERLLQNALLDNLTGLPNRQVFLDRLQAILLMSDGTNAVRPTVLA
FT                   IDIDRYKQVNDLLGIAAGDNILIALTRRLRRLLRPQDTLARLGGDQFGLILMSERDPAK
FT                   IADFADAVSKAIMVPLNYGNREINLTASIGLVSWLDQEQSAASLLDDAELAMFRAKKEG
FT                   GNRVEPFRPAFRTSGSDRLQLEADLKRAIERKELSLVYQPIVRLSDAEVAGFEALMRWD
FT                   HPKRGNVSPTEFIPIAENSDIINQLGMFAFDQATSDLSEWQIQTGDLPIFVSINLSSAQ
FT                   LLNSGLYDDVRAILNKNRCDPAKVKMELTESLVMENPEQARLVLEKLREAGLRLALDDF
FT                   GTGHSSLSYLTRFPFDTIKIDKALVRDPSDKRGVVLRSVIAMARELDMRVVAEGIESEE
FT                   DAIQLAQMGCDYGQSFLFGPPVGSESILRLLKERFPLMKRA"
     ttgatgcccc tgacccgcaa gccgttcgca tcgtccaccg caaggctggc ggcgtttctg        60
     gtcgcattcg ccgtcttcat cttcggtgtc gcgggcggcg ttgcccatgc gctcgagccc       120
     gtgaagatct cgcgcgagga cacggcgctc gacctgaccg cgacgacgga aatctattcg       180
     ggccgcggcg aggctttcca ggtgtccacc gcccccggaa cggacggcat cgtgcggcgc       240
     atcgaagtca gatcgagcac ggagcatcac cagggcgact gggccgtctt cgcgctcgcc       300
     aatgtttccg aagagcagct cgaacgggtg atcgtcgcgc cgcacttccg gctggtcaat       360
     tcgaaattgt tctggccgga tctcggctcg caacgcatcc tgtcgatcac gccgagcgag       420
     ggtttcgccc tcgaccggca gccgagcgac gaggcggatg tcttccgtat cacgctcaac       480
     cccggcgccg tcatcacctt cgtcgccgag cttgcaacgc cggagctgcc gcagatctat       540
     ctctggcaac cggatgccta caaggacacg gtcaacgcct ttacgcttta tcgcggcatc       600
     gtgctcggga ttgccgggct gctcgccgta ttcctgacca ttcttttcgt cgtcaagggc       660
     acctcgatgc tgccggcaac ggcagcgctc gcctgggcgg tccttgccta tatctgcgtc       720
     gacttcggct ttctgtcgaa gctgatcagc gtcacggcgg gcgacgaacg catatggcgc       780
     gccgggacgg aagtctttct ggcggcgggg ctggtcatct tccttttcac ctatctgaac       840
     ctcaaccgct ggcaccagca tctcggctat gcgacgctcg cctggattct cggcctggca       900
     ttgctgttcg gcgtcgccgt ctacgacccg gccatcgcgt cgggcattgc gcgcctctca       960
     ttcgcgctga cggcgaccgt cggcatcgtg ctgatcgcct atctcggctt caaccgctac      1020
     gaccgcgcca tccttctcgt gcccgcctgg ctgctgatcc tcgtctggct tttcggcgcg      1080
     tggctcgcgg tcaccgggca actcgccaat gatatcgtcc agccggcgct cggcggcggt      1140
     ctcgtgctga tcgtccttct gatcggcttc acggtcatgc agcacgcctt tgccggcggc      1200
     gcctaccagc agggcctctt ctccgacctc gagcggcagg cgctggcgct gaccggctcg      1260
     ggcgacaccg tctgggactg ggacgtggcg cgcgaccgtg tcgtgacgat cccggatatt      1320
     tcgcaccagc tcgggctctc gctcggcacg atgaacggac cggtccgcaa ctgggtgccg      1380
     cggctgcatc cggatgaccg cgaccgattc cgcgcgaccc ttgatgtgct gctcgaacat      1440
     cggcgcggac gcttgaacca tgagtttcgc gcccgcgccg aggacggcca ctatcactgg      1500
     ctttcgatcc gggcgcggcc ggtgctcggc gccaatggcg agatcatccg ctgcgtcggc      1560
     accatcgtcg acattaccga gcagcgcaat tcggtcgaac ggctcttgca gaacgcgctc      1620
     ctcgacaacc tcaccggcct gcccaaccgg caggtgttcc tcgaccgcct gcaggcgatc      1680
     ctcttgatgt ccgacggcac caacgccgtt cggccgaccg ttctcgccat cgatatcgac      1740
     cgctacaagc aggtcaacga cctgctcggg atcgccgccg gcgacaatat cctgattgcc      1800
     ttgacgcggc gtctgcggcg gttgctgcgc ccacaggaca ccttggcccg gctcggcggc      1860
     gaccagttcg gcctgatcct catgtccgag cgcgacccgg cgaagattgc agatttcgcc      1920
     gatgcggtca gcaaggcgat catggtgccg ctcaattacg gcaaccgcga aatcaacctc      1980
     accgcatcga tcggcctcgt atcctggctc gatcaggagc agagcgccgc aagcctgctc      2040
     gacgacgccg agcttgcgat gttccgcgcc aaaaaggagg gcggcaatcg cgtcgagccc      2100
     ttccggccgg ccttccggac ctccggttcg gatcgccttc agctcgaagc ggacctgaag      2160
     cgggcaatcg aacgcaagga gctgtcgctc gtctaccagc cgatcgtgcg gttgagcgac      2220
     gccgaggtcg ccggtttcga agcgctgatg cgctgggatc atccgaagcg cggcaatgtt      2280
     tcgccgaccg agttcatccc gatcgcggaa aactccgaca tcatcaacca gctcggcatg      2340
     ttcgctttcg accaggcgac gagcgacctt tcggagtggc agatccagac cggcgatctg      2400
     ccgatcttcg tctcgatcaa cctttcgagc gcgcagctcc tcaacagcgg cctttatgac      2460
     gacgtccgcg ccatcctcaa caagaaccgc tgcgatccgg ccaaggtgaa gatggaactc      2520
     accgaatcgc tggtgatgga aaacccggaa caggcccggc tcgttctcga aaaactgagg      2580
     gaagcgggat tgcggcttgc cctcgacgat ttcggcaccg ggcattcgtc gctttcctac      2640
     ctgacccgtt tccccttcga caccatcaag atcgacaagg cgctggtccg cgatccaagc      2700
     gacaagcgcg gcgtcgtgct gcgctcggtg atcgccatgg cgcgcgaact cgacatgcgg      2760
     gtcgtcgccg aaggcatcga gtcggaagag gatgcgatcc agctcgcaca gatgggctgt      2820
     gattatggcc agagcttcct gttcggcccg cccgtcggat cggaatcgat cctgcggctc      2880
     ctgaaagagc ggtttccgct tatgaagagg gcgtaa                                2916
//

If you have problems or comments...

PBIL Back to PBIL home page