(data stored in ACNUC7421 zone)

EMBL: CP001389.PE534

CP001389.PE534       Location/Qualifiers
FT   CDS_pept        complement(597154..598452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05420"
FT                   /product="peptidase, family M16 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24338"
FT                   /db_xref="GOA:C3MHL0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL0"
FT                   /protein_id="ACP24338.1"
FT                   /translation="MMKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVDEHG
FT                   IAHLLEHMAFKGTRRRSARQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAIDIL
FT                   ADILTESTFDEEELRREKHVILQEIGAADDTPDDVVFDRFAETAYRDQTVGRPILGTPE
FT                   TVMSFTPGQIRQYLGRNYTTDRMFIVAAGAVDHDSIVRQVQERFSSLPVAPLSPPVLDT
FT                   ARYTGGDSRESRDLMDAQVLLGFEGRAYHARDFYCSQILANILGGGMSSRLFQEVREHR
FT                   GLCYSVYAFHWGFSDTGIFGIHAATGGENLPELMPVIIDELRKSSTSIDQQEIERARAQ
FT                   IRAQLLMGQESPAARAGQIARQMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTA
FT                   PTLSAIGPLDQLAPMSDILSSLNTKSAVHALAG"
     atgatgaaag ttgagtgcac ccggctccct tccgggctga cggtggtgac cgagcgaatg        60
     ccgcatctgg aaagcgtggc gctcggggtc tggatcaaat ccggttcgcg caatgaaacc       120
     gtggatgaac acggaattgc gcatctgctg gagcacatgg ctttcaaggg gacgagacgg       180
     cgcagtgcgc gccagatcgc cgaagaaatc gaaaatgtcg gcggcgaggt caacgccgcc       240
     acctccaccg agacgacctc ctactacgcc cgggtgctca aggaccatgt gccgctggcg       300
     atcgacatcc tcgcggacat tctcacggaa tcgaccttcg acgaggaaga actccggcgc       360
     gagaagcacg tcatcctgca ggagatcggc gcggccgacg acacgccgga tgacgtggtc       420
     ttcgaccgct tcgccgagac cgcctatcgc gaccagacgg tcggacggcc gatcctcggc       480
     acgcccgaaa cggtgatgtc gttcacaccc ggccagatcc gccagtatct cggccgcaat       540
     tatacgactg acaggatgtt catcgttgcc gccggcgccg tcgaccacga ctcgatcgtg       600
     cgccaggtcc aggagcgctt ttcctccctg cccgtcgcgc cgctgtcgcc tccggttctc       660
     gatacggcgc gctataccgg cggcgacagc cgcgagagcc gtgacctgat ggacgcgcag       720
     gtgctgctcg gcttcgaagg cagggcctat cacgcccggg acttctactg ttcgcagatc       780
     ctcgccaaca tcctcggcgg cggcatgtcc tcgcgcctct tccaggaagt gcgcgaacat       840
     cgcgggctct gttattcggt ctacgccttc cattggggct tttccgatac cggcatcttc       900
     ggcattcatg ccgcgacggg cggcgagaac ctccccgagc tgatgccggt catcatcgac       960
     gaattgcgca agtcctcgac gagcatcgat cagcaggaga tcgagcgggc ccgcgcgcag      1020
     atccgggcgc aactgctgat gggacaggaa agcccggcgg cccgcgccgg ccagatcgcc      1080
     cgccagatga tgctctatgg gcgccccatt ccgaacgaag aactgatgga gcggctgtcc      1140
     ggcatcacga tagagcggct gaccgatctc gccggtcgtc ttttcttcga tacggccccg      1200
     acgctttcgg cgatcggccc cctcgatcag cttgccccga tgagcgatat tctgtcgtcc      1260
     ctgaacacca agtccgccgt ccacgccctc gccggctag                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page