(data stored in ACNUC7421 zone)

EMBL: CP001389.PE536

CP001389.PE536       Location/Qualifiers
FT   CDS_pept        600282..600830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24340"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL2"
FT                   /protein_id="ACP24340.1"
FT                   /translation="MSGNVSRHLLAMSVLLVAAGCNQTQNGGAIEAGGNANAPTPAVIQ
FT                   AACPPVMLRDGTASYRTYAKGGKDDPTKVVYQASLADTTRQCVQSADSLTVTVVAQGRV
FT                   VAGPAGGPGKLTMPIRVAATDGEKTLYSELTQYPVEIPTGSTTTQFVFTKADVTLPAGA
FT                   GSDAKIFVGFDEGPQKAKQ"
     gtgtctggca atgtgtctcg ccatcttctc gcaatgtctg tccttttggt cgccgcaggc        60
     tgtaaccaga cgcaaaacgg cggcgccatc gaagcggggg gcaacgcgaa cgcgccgacg       120
     ccggcggtga tccaggcggc ttgcccgccg gtgatgctga gagacggcac cgcctcctac       180
     cgcacctatg ccaagggcgg gaaggacgat ccgaccaagg tcgtctatca ggcgtcgctg       240
     gccgacacca cgcggcaatg cgtgcagagc gcagactccc tgacagtgac cgtggtcgcc       300
     cagggccgcg tcgtggccgg tcccgccggc ggtccgggca agctgacgat gccgatccgt       360
     gtcgccgcga ccgacgggga aaagacgctc tactccgagt tgacgcaata cccggtcgag       420
     attcccacgg gcagcaccac cacgcagttc gtcttcacca aggccgacgt caccctgccg       480
     gccggcgccg gatcggacgc caagatcttc gtcggcttcg acgaggggcc gcagaaggcg       540
     aagcagtag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page