(data stored in ACNUC7421 zone)

EMBL: CP001389.PE537

CP001389.PE537       Location/Qualifiers
FT   CDS_pept        complement(600926..602032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05450"
FT                   /product="amino acid ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24341"
FT                   /db_xref="GOA:C3MHL3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL3"
FT                   /protein_id="ACP24341.1"
FT                   /translation="MRLSLLTGMTLAAGMAFAPLAHADITLGVITPLTGPVAAFGEQVK
FT                   NGAEAAVEAINDAGGIKGEKLVLKIVDDAGEPKQSVSVSNQLAGEGVRYVVGPVLSGTA
FT                   MPASDVLAENGILMVTPTATTPDLTTRGLWNVLRTCGRDDQQAVVAADYVVKNLKDKRV
FT                   AVLHDKGAYGKGLADGFKAAINAGGITEVVYEGLNPGEKDFSAIVTRLKAENVDVVYFG
FT                   GYHAEAGLMIRQMRDQGVNAQLIGGDGLSNTEFWAIGADAAEGTIFTNASDATRNPAAA
FT                   PVIEALKAKNIPAEAFTLNAYAAVQVIKAGIEMAGSAEDATAVATAIKSGEEIDTVIGK
FT                   LTFGESGDLTSPSFSLYKWEAGKSVAAE"
     atgcgtcttt cactgttgac cggaatgacc ttggctgccg gcatggcctt cgcgccgctc        60
     gcccatgccg acatcacgct cggcgtgatc accccgctca ccggcccggt cgcggccttc       120
     ggcgagcaag tgaagaacgg cgccgaggca gccgtcgaag cgatcaacga tgccggcggc       180
     atcaagggcg aaaaactcgt cctcaagatc gtcgacgacg ccggcgaacc gaagcaatcc       240
     gtttcggtgt cgaaccagct cgccggcgaa ggggtacgct atgtcgttgg gccggtgctc       300
     tccggcactg caatgccggc atccgacgtg ctcgccgaga acggcatcct gatggtcacg       360
     ccaacggcaa ccacccccga tcttacgacg cgcgggctct ggaacgtgct gcgcacctgc       420
     ggccgcgacg accagcaggc cgtcgtcgct gccgactatg tcgtgaagaa cctcaaggac       480
     aagcgcgtcg ccgtgctgca cgacaaaggc gcctatggca aaggcctcgc cgatggcttc       540
     aaggccgcaa tcaatgcagg cggcatcacg gaagttgtct acgagggctt gaaccccggc       600
     gagaaggact tcagcgccat cgtcacacgt ctcaaggcag agaatgtcga cgtcgtctat       660
     ttcggcggct accacgccga ggccggcctg atgatccgcc agatgcgcga ccagggagtc       720
     aacgcgcaac tgatcggcgg cgacggtctc tccaacaccg agttctgggc gatcggcgcg       780
     gacgctgccg aggggacgat cttcacgaat gccagcgacg cgacccgcaa cccggccgcc       840
     gccccggtga tcgaagcgct caaggcgaag aacatcccgg ccgaggcctt cacgctcaat       900
     gcctatgcgg ctgtccaagt catcaaggcg ggcatcgaga tggcgggctc cgccgaggac       960
     gcgacagccg tcgcgacggc gatcaagtcc ggcgaggaga tcgacactgt gatcggcaag      1020
     ctgacctttg gcgaaagcgg cgacctcacc tcgccgagct tctcgctcta caaatgggaa      1080
     gccggcaaga gcgtcgcggc cgagtaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page