(data stored in ACNUC7421 zone)

EMBL: CP001389.PE538

CP001389.PE538       Location/Qualifiers
FT   CDS_pept        complement(602415..603110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24342"
FT                   /db_xref="GOA:C3MHL4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL4"
FT                   /protein_id="ACP24342.1"
FT                   /translation="MTGIDLIIFDCDGVLVDSEIIASEVQAELVSEAGFPISVEEMNER
FT                   FAGLTWRDTLLTIEREASIPLSASLIDRVDTILDKRLARDVKIIDGVKPVLLQLTLPHC
FT                   ICSNSTSARLATMLGKVGIKDHFGKHIYSARDLGPDRVKPKPDIFLHGAAQFGVDPARV
FT                   LVIEDSVHGVHGARAAGMRVVGFTGGSHTYPSHADKLTDAGAETVVSRMAALPGVIAAL
FT                   AEWSESLTA"
     atgaccggta tcgacctcat catcttcgac tgcgacggcg ttctcgtcga ttcggaaatc        60
     atcgcctcgg aagtccaggc agaactggtg agcgaggcgg gctttccgat cagcgtcgag       120
     gaaatgaacg agcgcttcgc cggcctgacc tggcgcgaca cgttgctgac gatcgagcgg       180
     gaagccagca tcccgctttc cgcctcgttg atcgaccgtg tcgacaccat tctcgacaag       240
     cggctggccc gtgacgtcaa gatcatcgac ggcgtcaagc cggtgctgct gcagctgacg       300
     ctgccgcact gcatctgctc gaactcgacc tctgcgcggc tcgcaacgat gctcggcaag       360
     gtcggcatca aggatcattt cggcaagcat atctactctg cgcgcgatct cggccccgac       420
     cgggtcaagc cgaagccgga catcttcctg cacggcgccg cccaattcgg cgtcgatccg       480
     gcacgcgtcc tcgtcatcga ggattcggtg cacggcgtgc atggcgcgcg cgccgcaggc       540
     atgcgcgtcg tcgggttcac cggtggttcg cacacctatc cctcgcatgc cgacaagctg       600
     acggacgcgg gcgcggagac cgtcgtctcc cgcatggcgg cgctgccggg cgtgatcgct       660
     gcgcttgccg aatggtccga gtccctgacg gcctga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page