(data stored in ACNUC7421 zone)

EMBL: CP001389.PE540

CP001389.PE540       Location/Qualifiers
FT   CDS_pept        604003..604422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24344"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL6"
FT                   /protein_id="ACP24344.1"
FT                   /translation="MVRLRGHHLLCLLTFVGEGYTPAFTGNFRLIAARLSNGEAIEIVE
FT                   GPDDICVPMLDRPEAHCRNTDIRDRDAWALAAIGERLGIALKAGSILNLDGQRLDALRA
FT                   AFAAGLIRAACHECEWSGFCTRIARDGFEGTLVQS"
     atggttcgac ttcggggaca tcatctcctc tgtctgctca ccttcgtcgg cgagggctac        60
     acccccgcct tcacgggcaa ctttcgcctg attgccgcac gtctttcgaa cggcgaagca       120
     atcgagatcg tcgaagggcc ggacgacatc tgcgtcccga tgctggatcg gcccgaagcc       180
     cattgccgca acaccgacat tcgcgaccgc gacgcgtggg ctctggcggc aattggcgag       240
     cgacttggta tcgcgctcaa ggccggctcg attctcaacc tcgacggtca gcgcctcgat       300
     gccttgcgcg ccgccttcgc ggccggtctg atccgcgccg cctgccatga atgcgaatgg       360
     tccgggtttt gcacgcgcat cgcccgtgac ggcttcgaag ggaccctggt tcagagctaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page