(data stored in ACNUC7421 zone)

EMBL: CP001389.PE541

CP001389.PE541       Location/Qualifiers
FT   CDS_pept        complement(604473..605153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05490"
FT                   /product="probable transcriptional regulator protein, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24345"
FT                   /db_xref="GOA:C3MHL7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL7"
FT                   /protein_id="ACP24345.1"
FT                   /translation="MKEGPDIALIGSLIGDPARANILTALMAGQALTPTELAAHAGITL
FT                   QTASSHLAKLEAGGLLTQRKQGRHRYYALSEDEVGLMLESLMGFAASRGLTRHRPGPKD
FT                   PALRKARVCYNHLAGDYGVRLLDSLVAARQIEVTGDDLALTDAGRDRVEALGIDYDALS
FT                   KSRRPICRTCLDWSERRSHLAGSLGEALLTLFIDKGWAKREKDSRAVRFSDKGEKAFLE
FT                   FFPL"
     atgaaggaag gtcccgacat agctctcatc ggatcgctga tcggcgatcc ggcgcgcgcc        60
     aacatactga ctgcgctgat ggccggccag gcactgacgc cgacggagct tgccgcccat       120
     gccggaatca cgctgcagac cgcaagctcg catctcgcca agctggaagc cggcggactg       180
     ctgacgcagc gcaagcaggg tcggcatcgc tactatgcgc tcagcgagga cgaggtcgga       240
     ttgatgctcg aaagcctgat gggcttcgcc gccagccgcg gcctgacgcg gcatcggccg       300
     ggaccgaagg acccggcgct gcgcaaggca cgcgtctgct acaatcatct ggccggcgac       360
     tatggcgtcc gcctgctgga cagcctcgtc gccgcccgtc agatcgaagt gaccggagat       420
     gaccttgccc tgaccgacgc aggcagggac cgcgtcgagg cactcggcat cgactacgac       480
     gcactcagca agtcccgacg gccgatctgc cgcacctgtc tcgactggag cgagcgccgt       540
     tcgcacctcg ccggctcgct cggcgaggct ttgctcacgc ttttcatcga caagggctgg       600
     gcaaagcgcg agaaggacag ccgcgccgtc cgcttcagcg acaagggaga gaaggccttc       660
     ctggagttct ttccgctata g                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page