(data stored in ACNUC7421 zone)

EMBL: CP001389.PE542

CP001389.PE542       Location/Qualifiers
FT   CDS_pept        605328..605648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05500"
FT                   /product="NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24346"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL8"
FT                   /protein_id="ACP24346.1"
FT                   /translation="MLTCFIRYEIDPFRKEDFATYARNWGEAIPRCGADLIGYFGPHEG
FT                   SATAAYGVYNIESLAAYEAYRARLAADPLGRENYEFARRERFILKEDRIFLKNLPLPYG
FT                   KE"
     atgctcacct gcttcatccg ctatgagatc gatccgttcc gcaaggagga tttcgccacc        60
     tatgcccgca actggggcga ggccatcccg cgctgcggcg ccgatctcat cggctatttc       120
     ggtccgcacg aaggctcggc gaccgccgcc tatggcgtct acaacatcga gagcctcgcc       180
     gcctacgagg cctaccgggc gcggctcgcc gccgatccgc tcggtcgcga gaactacgag       240
     ttcgcccggc gcgagcgctt catcctcaag gaggaccgca tcttcctgaa gaacctcccg       300
     ctgccgtatg gaaaggagtg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page