(data stored in ACNUC7421 zone)

EMBL: CP001389.PE543

CP001389.PE543       Location/Qualifiers
FT   CDS_pept        605653..606009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24347"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL9"
FT                   /protein_id="ACP24347.1"
FT                   /translation="MIAVIFEVLPSEGERATYLGLAADLRPLLDRIDGFISIERFQSLA
FT                   DPNKLLSLSFWRDEEAVKAWRNGAEHRAAQGAGRNGVFADYRLRIAAVVRDYGLNHRDE
FT                   APADSRQWHEGNAA"
     atgatcgctg tgattttcga agtcctgcca tccgagggcg aacgcgccac ctatctcggc        60
     cttgccgccg acctgcgtcc gctgctggac cggatcgacg gcttcatctc catcgagcgc       120
     ttccagagcc tcgccgaccc gaacaagctg ctgtcgctct ctttctggag ggatgaagag       180
     gcggtgaagg cctggcgcaa tggcgccgag catcgtgcgg cgcaaggcgc ggggaggaac       240
     ggcgtcttcg ccgactatcg gctgaggatt gccgcggtcg tcagggacta cggcctcaat       300
     catcgcgatg aggcgccggc ggacagccgg caatggcatg agggcaacgc cgcctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page