(data stored in ACNUC7421 zone)

EMBL: CP001389.PE545

CP001389.PE545       Location/Qualifiers
FT   CDS_pept        607776..609026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05530"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-13i"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24349"
FT                   /db_xref="GOA:C3M8X8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3M8X8"
FT                   /protein_id="ACP24349.1"
FT                   /translation="MTDQKQFYAGVDWASESHHVFLTDGDGRKIGERVFRHGGEGLAEL
FT                   AAWLTATSGATEAGQIQVAIEVPHGPVVETLIERGCQVHAINPKQMDRFRDRFTLAGAK
FT                   DDSRDAEVMASALRTDRRCFRLLAAADPVVIELREWSRMAEDLGAERNRLTNRMREQLW
FT                   RYFPALLELENDLGAEWLLDLWEAVPTPAKAARIRAATIAKLLKRNRIRRVDATHVLAV
FT                   LRTPPVKVAAGTTEAASAHIATLIARIRLVNRQLKQAHQRLDTLTARLVPTEATEPGQR
FT                   KQHDVEILASLPGVGRIVLATLLAEAFDALQRRDHAALRSLTGVAPVTKRSGKSCIVIR
FT                   RQACHDRLANAMYHWARVAIQHDSRSRLKYAALRSRGHSHGRALRSVADRLLNVACAML
FT                   KTGTTFNPSLAEQKLSC"
     atgaccgatc agaaacaatt ctatgccggc gtcgactggg cgtcggagag ccatcatgtg        60
     ttcctcacgg atggtgatgg ccggaaaatc ggcgaaaggg tcttcaggca cggcggcgaa       120
     gggctcgccg agctggcggc ctggctgacg gcaaccagcg gtgcaaccga ggccgggcaa       180
     atccaggtcg cgatcgaggt gccgcacggg cccgtggtcg agacgctgat cgagcgcggc       240
     tgccaggtgc atgccatcaa cccgaaacaa atggatcgct ttcgcgaccg gttcaccctg       300
     gccggcgcca aggacgacag ccgcgatgcc gaagtgatgg cctcggcctt gcgcaccgat       360
     cgccggtgct tccggctgct cgccgccgcc gatcctgtcg tcatcgaatt gcgcgaatgg       420
     tcgcgcatgg ccgaggacct cggcgccgag cgcaaccggt tgaccaaccg catgcgcgag       480
     cagctctggc gctactttcc tgcgctgctc gagctcgaaa acgacctcgg ggccgagtgg       540
     ctgctcgatc tctgggaagc cgtgccgacg ccggccaaag ccgcgcggat ccgcgcggcg       600
     acgatcgcca agcttctcaa acgcaaccgc atccgccgcg tcgacgccac ccatgtgctc       660
     gccgtgctgc gcacgccgcc cgtcaaggtc gccgccggga cgaccgaagc cgccagcgcc       720
     cacattgcca cgctcattgc ccgcattcgc ctcgtgaacc ggcagctcaa gcaagcgcat       780
     cagcggctcg ataccctgac tgcccgcctt gtcccgaccg aggcgaccga gccggggcag       840
     aggaagcagc atgacgtgga gatcctcgca tccttgccgg gagtgggaag gatcgtcctc       900
     gccacgctgc tcgcagaagc cttcgatgcc ctgcagcgac gtgaccacgc cgccttgcgc       960
     agtttgacag gagtcgcgcc cgttaccaag cggtccggca agagctgcat cgtcatcaga      1020
     agacaggcct gccacgaccg gctcgccaac gccatgtacc attgggcacg cgtcgccatt      1080
     cagcacgact ctcggagccg tttgaagtac gccgcccttc gaagccgagg tcacagccac      1140
     ggtcgtgccc tgcgatccgt cgccgaccgc ctcctcaacg tcgcatgcgc aatgctgaaa      1200
     accggcacca ccttcaatcc ttccttggcc gagcagaaac tctcttgcta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page