(data stored in ACNUC7421 zone)

EMBL: CP001389.PE546

CP001389.PE546       Location/Qualifiers
FT   CDS_pept        complement(609118..610155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24350"
FT                   /db_xref="GOA:C3MHM2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM2"
FT                   /protein_id="ACP24350.1"
FT                   /translation="MVTRIYGSNFADILKQNSYIEVEIYGYDGDDDIYLNRTDSYGGYN
FT                   FVDAGYGNDLVVNYYEGGNDIYMGAGNDIYVADIRARDTSSYDVVYGGSGNDRFEINGY
FT                   ASDYYGESGNDTFLSAGFNNYFNGGTGIDAISYQFQDDWSSERGKGVTIDLGYKYATTG
FT                   SGRREDLISIENATGTNYGHDDIAGSSVANTLRGLGGHDILEGLGGDDFLDGGSGDDDL
FT                   YGGSGADILRGGTGFDYLVGGTGTDSFDFNAISESVVGSRRDVIADFHRSEYDVIDLST
FT                   IDADTTWSGNQKFTYIGGSAFTGDAGQLNFRSGILSGDINGDGLADFQIKVNGVTSLRV
FT                   DDFFL"
     atggtcacgc gcatctacgg ttcgaacttc gccgatatcc tcaagcagaa cagctatatc        60
     gaggtcgaga tctatggcta tgacggcgac gacgacatct atctgaacag gaccgacagc       120
     tacggcggat acaactttgt cgatgcgggt tacggcaacg atctcgtggt gaactactac       180
     gaaggcggca acgacatcta tatgggcgcc ggcaacgaca tctacgtcgc cgacattcgg       240
     gcacgcgaca cgagctccta cgacgtcgtt tacggcggca gcggcaatga ccgcttcgaa       300
     atcaacggtt atgccagcga ctactatggc gaaagcggca acgacacctt cctctcggcc       360
     ggctttaaca actacttcaa cggcggcacg ggtatcgacg cgatcagcta tcagttccag       420
     gacgactgga gctcggagcg cggcaagggc gtcacgatcg acctcggcta caaatatgcg       480
     accaccggca gcggccggcg cgaggacctg atcagcatcg agaatgccac cggcacgaat       540
     tacggccatg acgacattgc cggcagttcg gtcgccaaca cgctgcgcgg cctcggcggc       600
     cacgacattc tcgaggggct cggcggcgac gatttcctcg acggcggcag cggtgacgac       660
     gatctctatg gcggctccgg cgccgatatc ctgcgcggcg gcactggctt cgactatctg       720
     gtcggcggca ccggcaccga cagcttcgat ttcaacgcga tcagcgaatc ggtcgtcggc       780
     agcaggcgcg acgtgatcgc cgatttccac cgctccgaat acgacgtcat cgatctctcg       840
     acgatcgacg cggacacgac ctggagcggc aatcagaaat tcacctatat cggcggcagc       900
     gcctttacgg gagacgccgg ccagttgaac ttccgttccg gaattctctc gggcgacatc       960
     aacggcgatg gccttgccga cttccagatc aaggtgaacg gcgtgaccag tctcagggtc      1020
     gacgatttct ttctgtga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page