(data stored in ACNUC7421 zone)

EMBL: CP001389.PE550

CP001389.PE550       Location/Qualifiers
FT   CDS_pept        613077..613883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05580"
FT                   /product="putative disulfide bond formation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24354"
FT                   /db_xref="GOA:C3MHM6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM6"
FT                   /protein_id="ACP24354.1"
FT                   /translation="MSASVTSLPKRLLSGVAIAALALVLAACSEEKKEAASKAPAETSA
FT                   SADAMTTASTTATPAASRAKPAGTEVAQAAAPAKAELPQSEGSVDVQKLMEPGALPEMA
FT                   LGEANAPVTIVEYMSMTCPHCANFHNKTFDAIKAKYIDSGKVRFIVREFPFDPRAAAAF
FT                   MLARCAPEGQYFPMVSMLFKQQEQWAAAENGRDALLQMSKLAGFTQESFEACLTNQKLL
FT                   DDVNAVMQRGAKEFGVKSTPTFFVNGEHYSGDMSVDVLSALIDSKL"
     atgtccgctt ccgtaacgag ccttccgaaa cgcctgctga gcggcgtcgc catcgccgcg        60
     ctcgccctgg tgcttgccgc ctgcagcgaa gagaagaagg aggcggcttc caaggcgccg       120
     gccgaaacgt cggcgagtgc ggatgcgatg accaccgcgt ccacgaccgc aacgccggcc       180
     gccagccggg caaagcccgc cggcaccgaa gttgcgcagg ccgccgctcc ggccaaggcc       240
     gagctgccgc agtcggaagg cagcgtcgac gtgcagaagc tgatggagcc cggcgcactt       300
     ccggaaatgg cgctgggcga ggccaatgcc ccggtgacga tcgtcgaata catgtcgatg       360
     acctgcccgc actgcgccaa cttccacaac aagaccttcg atgccatcaa ggcgaaatat       420
     atcgacagcg gcaaggtgcg cttcatcgtc cgcgaattcc ccttcgatcc gcgcgccgcg       480
     gccgccttca tgctggcgcg ctgcgccccc gagggacagt atttcccgat ggtttccatg       540
     ctgttcaagc agcaggaaca gtgggccgcc gcggaaaacg gccgcgatgc actgctgcaa       600
     atgtcgaaac tcgccggttt tacacaggag agcttcgagg cctgcttgac gaaccaaaaa       660
     cttctggatg atgtgaacgc agtcatgcag cgcggcgcca aggagttcgg agtgaaatcg       720
     acgccgacct ttttcgtgaa tggcgagcat tattcggggg acatgtcggt tgacgtactg       780
     tcggccctca tcgacagcaa gctctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page