(data stored in ACNUC7421 zone)

EMBL: CP001389.PE551

CP001389.PE551       Location/Qualifiers
FT   CDS_pept        613970..614341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24355"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM7"
FT                   /protein_id="ACP24355.1"
FT                   /translation="MPHADVPPKARANARRMRSAMTDAELKLWSELRAHRLLGLAFRRQ
FT                   VPVAGYIVDFACAEHRLIIEVDGSQHASTGNADYDRQRTQHFESHGWTVLRFWNDDVLS
FT                   DIDNVCEHIVRVIGKGAFK"
     atgcctcacg ctgacgtccc gccgaaagct cgcgccaatg cccgccgcat gcgaagcgcc        60
     atgacggatg cggagctcaa gctctggagc gagttgcgcg cgcaccgact gttgggccta       120
     gctttccggc ggcaggttcc ggtagccggc tacatcgtcg attttgcctg cgccgagcat       180
     cgcctgatca ttgaggttga tggttcacag catgcgagca cggggaatgc cgattacgat       240
     aggcagcgca cccagcattt cgaatcgcat ggctggacgg tcttgcgctt ctggaatgat       300
     gatgttttga gcgacatcga caatgtctgc gaacacattg tgcgtgtgat cgggaagggg       360
     gcgtttaagt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page