(data stored in ACNUC7421 zone)

EMBL: CP001389.PE552

CP001389.PE552       Location/Qualifiers
FT   CDS_pept        614565..618026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05610"
FT                   /product="chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24356"
FT                   /db_xref="GOA:C3MHM8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM8"
FT                   /protein_id="ACP24356.1"
FT                   /translation="MKFNKLRLLGFKSFVEPTEFIIERGLTGVVGPNGCGKSNLVEALR
FT                   WVMGENSYKNMRASGMDDVIFSGSGNRPARNTAEVGLYLDNSDRTAPAAFNDSDEIQVT
FT                   RRIEREQGSVYRINGKEARAKDVQLLFADASTGARSPSMVGQGRIGELIAAKPQARRQL
FT                   LEEAAGISGLHSRRHEAELRLKAAETNLERLDDVTSQLESQIESLKRQSRQANRFKMLS
FT                   AEIRRHEAILLHIRWVQAKEAESEAASQLNQITALVAEKAQAQMEAAKHQAIASLKLPE
FT                   LRENEAKLAAALQRLQIARAQLEEDAGRILRRRDELQRRLSQLAEDIAREERLVADNSG
FT                   ILSRLDEEEEELKEVLAEADDRAAEAREKLVEAGEKLSDSEADLARLTAERAEAQAARN
FT                   QLDRTLRDLSERQARLARQLSDQARDLEALDRQMAALPDPHEKQEQVEAAEAALEEAEA
FT                   VVVAVEESLAEARAEEAATRPPVDQARALLNGIETEARTIRRMLEASGASDYPAVVEDM
FT                   QVERGFETALGAALGDDLDSPLEQAAASHWRMPGDDADDPALPRGALPLSDYVSAPEAL
FT                   GRTLRQIGIVESETEAERLLPLLKSGQRLVTKEGAVWRWDGHVTGSEAPSAAALRLAQK
FT                   NRLSELEAEAEDAAGALRQAEADLAAAGARIRAEDERLRLSRDAQRMITRQLAEARDAL
FT                   AAAERASGDLARRRAVLAETKLQLEGQVEEAAEQIEAANDALAEAPDLAELELRLRART
FT                   ADVAADRAAVAEARATHDGLARETEARLRRLSAIAGERETWRARASSAEEHIATLRDRE
FT                   AEAREEVEELIDAPDEFEDKRRALMNELQKAETARRQAADILAEAETRQREADRLAATA
FT                   LSELAEAREKRGRAEERLVSARERRVEIEARILEALSCPPHEAMRLTGLAADAALPDMR
FT                   AIERELERLKIERERLGAVNLRADEEQKELSERLAALLKERDDVIEAIRKLRSAIQNLN
FT                   REGRERLIAAFDVVNVQFQRLFTHLFGGGTAELQLIESDDPLEAGLEILARPPGKKPQT
FT                   MTLLSGGEQALTAMALIFAVFLTNPAPICVLDEVDAPLDDHNVERYCNLMDEMAASTET
FT                   RFIIITHNPITMARMNRLFGVTMAEQGVSQLVSVDLQTAERMREAV"
     atgaagttca acaagcttcg cctgctcggc ttcaagtcct tcgtcgaacc gaccgaattc        60
     atcatcgaac ggggcttgac cggcgtcgtc ggtccgaacg gttgcggcaa gtcgaacctc       120
     gtcgaggcgc tgcgttgggt gatgggggag aattcctaca agaacatgcg cgcctccggc       180
     atggacgacg tgatcttttc cgggtcgggc aaccggccgg cgcgcaatac cgccgaggtc       240
     ggactctatc tcgacaacag cgaccgcacc gcgcctgccg ccttcaacga cagcgacgag       300
     atccaggtga cgcggcgcat cgagcgcgag cagggttcgg tgtaccggat caacggcaag       360
     gaggcgcggg caaaggacgt ccagctgctc ttcgccgacg cctcgacggg cgcccgttcg       420
     ccgtcgatgg tcgggcaggg ccggatcggc gagcttatcg ccgccaagcc ccaggcccgc       480
     cggcaattgc tcgaagaggc ggccggcatt tccggcctgc actcgcgccg tcatgaggcc       540
     gaactgcgcc tcaaggcggc ggagacgaac ctggagcgtc tggacgacgt cacatcgcag       600
     ctcgaaagcc agatcgagag cctgaaacgc cagtcgcgcc aggcgaaccg cttcaagatg       660
     ctgtcggcgg agatccgccg gcacgaggcg atcctgctgc acatccgctg ggtgcaggcc       720
     aaggaggcgg agtccgaggc cgccagccag ctgaaccaga tcaccgcact cgtcgccgaa       780
     aaggcgcagg cgcagatgga ggcggccaag catcaggcaa tcgccagcct caaactgccg       840
     gaactgcgtg agaacgaggc aaagctggcg gcggcgctgc agcgcctgca gatcgcccgg       900
     gcgcagctcg aggaagatgc cgggcgcatc ctgcggcgtc gcgacgaatt gcagcggcgg       960
     ctatcgcagc ttgccgagga catcgcccgc gaggaacggc tcgtcgccga caattccggc      1020
     attctctccc gcctcgatga ggaggaagaa gaactcaagg aggtgcttgc cgaagccgac      1080
     gaccgcgccg cggaggcgcg cgaaaagctc gtggaagccg gcgaaaaact ttccgacagt      1140
     gaggcggatc tggcgcggtt gaccgccgaa cgcgccgagg cgcaggcggc ccgcaaccag      1200
     ctcgacagga cgctgcgcga tctttccgag cggcaggccc gacttgcccg ccagctttcc      1260
     gatcaggcgc gcgacctcga agcgctcgac cgccagatgg cggcgctgcc ggacccgcac      1320
     gagaaacagg aacaggtcga ggcagcggaa gcggcgctgg aggaggccga ggcggtcgtc      1380
     gtcgccgtcg aggagagcct tgccgaggcg cgcgccgaag aagcggccac ccgaccgccc      1440
     gtcgatcagg cgcgggcgct gctgaacggt atcgagaccg aggcccggac gatccgccgg      1500
     atgcttgaag cttccggcgc cagcgactat ccggccgtcg tcgaggacat gcaggtcgag      1560
     cgcggcttcg agacggcgct cggcgccgca ttaggcgacg acctcgattc gccgctggaa      1620
     caggcggcag cctcgcactg gcgcatgccc ggcgacgatg cggacgaccc cgccttgccc      1680
     agaggtgcct tgccgctgag cgattacgtc agcgccccgg aggcgctcgg ccgcaccctt      1740
     cgtcagatcg gcatcgtcga gagtgaaacg gaggccgaac ggctgctgcc gctcctgaag      1800
     tccggccagc ggctggtgac gaaggaaggc gcggtctggc gttgggatgg ccacgtcacc      1860
     ggatctgagg cgccgagcgc tgccgccctc cggctggccc agaagaaccg cctttccgag      1920
     ctcgaggctg aggccgagga tgccgctggg gccctgcgcc aggcggaggc ggatctcgcc      1980
     gccgccggcg cccgcatccg cgccgaggac gagcgtctgc gcctgtcgcg cgatgcccag      2040
     cggatgatca cccggcagct tgccgaggcg cgcgacgcgc ttgccgcggc cgaacgcgcc      2100
     tccggcgatc ttgcccgccg gcgcgccgtg ctcgccgaga cgaagcttca gctcgaaggc      2160
     caggtcgaag aggcggccga gcagatcgag gcggcgaacg acgcgctggc cgaggcgccc      2220
     gaccttgcgg aactggagtt gcggctgcgc gcccggacgg cggacgttgc ggcggaccgt      2280
     gccgcggttg ccgaagcgcg ggcgacgcat gacggtcttg cccgcgaaac cgaggcgcgt      2340
     ctgcgccggc tttccgcgat cgcaggcgag cgcgagacct ggagggcgcg cgcgtcgagc      2400
     gccgaagagc acatcgcgac gctgcgcgac cgcgaggcgg aggcgcgcga ggaggtcgag      2460
     gaacttatcg acgcgcccga tgagtttgag gacaagcgcc gcgccctgat gaacgagttg      2520
     cagaaggcgg agacggcgcg tcgacaggcg gccgacatcc tcgccgaggc ggagacccgc      2580
     cagcgtgaag ccgatcgcct cgccgcgacg gcgctttcgg agcttgccga agcgcgcgaa      2640
     aagcgcggcc gggccgaaga gcgtctggtc tcggcccgcg agcggcgcgt cgagatcgag      2700
     gcgcgcattt tggaggcgct ttcctgcccg ccgcatgagg cgatgcgcct gaccggactg      2760
     gccgccgacg cggcattgcc tgacatgcgc gccatcgagc gggagctcga gcgtctgaag      2820
     atcgagcggg agcgtctcgg cgccgtcaac ctgcgcgccg acgaggagca aaaggagctc      2880
     tccgaacggc tcgcagccct cctcaaggag cgcgacgatg tcatcgaggc gatccgcaag      2940
     ctgagaagcg ccatccagaa cctcaatcgc gagggtcgcg aacggctgat cgccgccttc      3000
     gacgtggtca atgtgcagtt ccagcggctc ttcacccatc tcttcggcgg cggcacggcg      3060
     gagctgcaat tgatcgagag tgacgatccg ctggaagccg gcctcgaaat ccttgcccgt      3120
     ccgccgggca agaagccgca gaccatgacg cttctgtccg gcggcgagca ggcgttgacg      3180
     gcaatggcgc tgatcttcgc ggttttcctc accaatccgg cgccgatctg cgtgctcgac      3240
     gaggttgatg caccgctcga cgaccacaat gtcgaacgct attgcaacct gatggatgaa      3300
     atggcggcct ccaccgagac ccgcttcatc atcatcaccc ataacccgat caccatggcc      3360
     cgcatgaacc gcctgttcgg cgtcacgatg gccgagcagg gcgtctccca gctcgtctcc      3420
     gtcgacctgc agacggccga gcgaatgcgc gaagcggtct ga                         3462
//

If you have problems or comments...

PBIL Back to PBIL home page