(data stored in ACNUC7421 zone)

EMBL: CP001389.PE556

CP001389.PE556       Location/Qualifiers
FT   CDS_pept        622025..622933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05650"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24360"
FT                   /db_xref="GOA:C3MHN2"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN2"
FT                   /protein_id="ACP24360.1"
FT                   /translation="MMVRYERPYSHAAHWARRLARIGFVIFALSLAAHRFGPLTTPHFL
FT                   ALAGCAVAFALLAVLLATVGLTRLWKVAAIGGTASVSALFYAALPLGFFLHGAAQYLAR
FT                   PAIYDVSTDPVTPPPWIKAPVAEESWITRRPIVTPEDREAQIAAYPGLTGRRYDGALDR
FT                   VFQSVRKVVEERRIATTAELGVENARADLEDLAVGPGAGADTNREPEAIPVPATRPAPD
FT                   IEAGIPGRDASDIVLQGEWRTLIAGFRFDVLIRLREEAETTLVDLRVASRYGQHDLGMG
FT                   AKFAEEFLRALDAELLGIAGD"
     atgatggtcc ggtacgagcg tccctattcc catgccgccc actgggcacg caggcttgcc        60
     cgcataggct tcgtgatctt cgcgctgtcg cttgccgcgc accgcttcgg accgctgacg       120
     acgccgcatt tcctggcgct cgccggctgc gccgttgcat ttgccctgct ggctgtcctg       180
     cttgcgaccg tcggccttac gcgcctctgg aaggtggcgg ccatcggcgg gaccgcttcc       240
     gtctcggccc tattctatgc ggcgcttcca ctcggcttct tcctccatgg ggccgcgcaa       300
     tatctggcgc gaccggcgat ctatgatgtc agcaccgatc cggtgacgcc gccgccatgg       360
     atcaaggcgc cggtcgccga ggagagctgg atcacgcgcc ggccgatcgt gacgcccgag       420
     gaccgcgaag cgcagatcgc cgcctatccg gggctcaccg gacggcgcta cgacggcgcc       480
     ctggaccgcg tgttccagag cgttcgcaag gtcgttgagg aaaggcggat cgccacgacc       540
     gcggaactcg gcgtcgagaa cgcgcgcgcc gatctcgagg accttgccgt gggtcccggc       600
     gcgggggcgg atacgaacag ggaaccggag gccattcccg ttcctgccac gcggccggcg       660
     cccgatatcg aggctggaat acccgggcgg gatgccagcg atatcgttct tcagggcgaa       720
     tggcgcacgc tgatcgccgg ctttcgcttc gacgtgctga tccggctgcg cgaagaggcg       780
     gagaccaccc ttgtcgacct gcgcgtcgcc tcgcgatacg gccagcatga tctcggcatg       840
     ggcgcaaaat tcgcggaaga gttcctgcgc gcgctcgatg cagagctgct ggggattgcc       900
     ggagattag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page