(data stored in ACNUC7421 zone)

EMBL: CP001389.PE557

CP001389.PE557       Location/Qualifiers
FT   CDS_pept        complement(622941..623852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05660"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24361"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN3"
FT                   /protein_id="ACP24361.1"
FT                   /translation="MQGPDFDLDFKPAHGEKVTVAEGVERITVNNPGPFTFHGTNSYIV
FT                   GRHSVAVIDPGPEDEAHFQGLMAALAGREVTHIAVSHTHRDHSPLVRRLKEATGAVVVG
FT                   EGPHRAARPLHAGETNPFAESSDMEFVPDVALRDGARIEGDGWSLTAIATPGHTANHMA
FT                   FGLDGTGILFSADHVMAWATSIVAPPDGAMADYMASLDKLLSRDDRLYLPGHGGPVSEP
FT                   PAFLRALKAHRKMRERAVLERLRAGDRNIPDMVKVIYASTDPRLHGAAALSVLAHIEDL
FT                   IEQGRIETDGPPSLLGEYRLVT"
     atgcagggac cggacttcga cctcgatttc aagcccgccc atggagaaaa ggtgacggtg        60
     gccgagggcg ttgagcgcat caccgtcaac aatcctggcc ccttcacctt ccatggcacc       120
     aacagctaca tcgtcggccg ccactccgtc gcggtgatcg acccggggcc ggaggacgag       180
     gcgcattttc aggggctgat ggcggcgctt gcagggcgcg aggtgacgca catcgccgtc       240
     agccatacgc atcgcgacca ctcgcctctc gtccgccggc taaaggaagc gacaggagcc       300
     gtcgtcgtcg gcgaaggtcc gcaccgggcg gctcgcccgt tgcacgccgg cgagaccaat       360
     cccttcgccg aaagctcgga catggaattc gttcccgacg tcgcccttcg cgacggcgcc       420
     cggatcgagg gcgacgggtg gagcctgacg gcgatcgcca cgccggggca caccgccaat       480
     cacatggcct tcgggctcga cggcaccggc attctcttct ccgccgatca cgtaatggcg       540
     tgggcgacga gcatcgtcgc gccgccggac ggtgccatgg ccgactacat ggcttcgctc       600
     gacaagctgc tctcacgcga cgaccggctg tacctgcccg gccacggcgg tccggtcagc       660
     gagcctcccg ccttcctgcg ggcgctcaag gcacatcgca agatgcgcga acgcgccgtc       720
     ctggaacggc tgcgcgccgg ggaccggaat atccctgata tggtgaaggt gatctacgcc       780
     tcgaccgatc cgcggctgca cggcgcagcg gcgctttcgg tgctcgccca tatcgaggac       840
     ctgatcgaac aaggccgcat cgagaccgac ggcccgccgt cgctcctcgg cgaatatcgg       900
     ctggtgacct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page