(data stored in ACNUC7421 zone)

EMBL: CP001389.PE558

CP001389.PE558       Location/Qualifiers
FT   CDS_pept        complement(623864..624160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24362"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN4"
FT                   /protein_id="ACP24362.1"
FT                   /translation="MTKFRARPPAVPTVLVDDAVVRIIRWDFEPGADTGHHVHGLGYVV
FT                   VPMTDCQFLVEEEEGSRRIDVAKGAAYRRDAGVAHNVVNAGSEPMSFVEIEYK"
     atgaccaagt tccgcgcccg cccgcctgcc gtcccgaccg ttctcgtcga tgatgccgtc        60
     gtgcgcatca tccgttggga tttcgaaccc ggcgccgaca ccgggcatca cgtccacggg       120
     cttggttatg tcgtcgtgcc gatgacggat tgccagttcc ttgtggaaga ggaagagggc       180
     agccgccgga tcgatgtggc aaagggcgcc gcctaccggc gcgatgcggg cgtcgcccac       240
     aatgtcgtca atgcgggcag cgaaccgatg tccttcgtcg agatcgagta caagtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page