(data stored in ACNUC7421 zone)

EMBL: CP001389.PE559

CP001389.PE559       Location/Qualifiers
FT   CDS_pept        complement(624613..625893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24363"
FT                   /db_xref="InterPro:IPR016883"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN5"
FT                   /protein_id="ACP24363.1"
FT                   /translation="MPTEQDLGRLQFTTLLYYLQCTNPDNGLVRDKTEPNAPASIAAIG
FT                   MALATIPVVVERGVIIRKFAAKIARKRLEFLLGCPQGPEPDASGYKGFFYHFLDIETGR
FT                   RVWECELSTIDSAFLFAGALTAAAYFDGEDADEAKIRMLANALYERADWNWACDHGLTL
FT                   THGWRPESGFIPYRWRGYDEGLLLYILGLGSPTHPLPPEAYAAYTESYEWRNIYGRELL
FT                   YSGPLFTHQLSHMWIDFRGIRDAFMRDRDTDYFQNSRQATYVQQEYAIRNPMNFRGYGE
FT                   HCWGFTACDGPGWTKKQLDGVEREFFDYIARGAPFGPDDGTVSPWVVVASLPFAPEIVI
FT                   PTVRNFAQMNLGMTHLYGFKPSFNQTYAVEGNDAGWWVSPYHFGIDQGPVVLMIENFRT
FT                   GLLWNIMRRSQPIVTGLRRAGFTGGWL"
     atgccgaccg aacaggatct cggccgtctg cagttcacga cgctcctgta ctatctgcaa        60
     tgcaccaatc ctgacaacgg cctcgttcgc gacaagaccg agcccaatgc tccggcgagt       120
     atcgccgcga tcggaatggc gctggcaacg atcccggtcg tcgtcgagcg cggcgtcatc       180
     atccggaaat ttgccgccaa gatcgcgcga aagcggctgg aattcctgct gggttgtccc       240
     caaggcccgg aacccgacgc ctcggggtac aaggggttct tctaccattt cctcgacata       300
     gaaaccggcc gccgggtctg ggagtgcgaa ctgtccacca tcgattcggc cttcctgttc       360
     gccggagcat tgaccgcagc cgcctacttc gatggcgagg atgccgacga ggcgaagatc       420
     agaatgcttg ccaacgcgct ctacgaacgg gcggattgga actgggcctg cgatcacgga       480
     ctgacgctga cccacgggtg gcgaccggaa agcggcttca ttccctatcg ctggcgcggc       540
     tacgacgagg gcctgctgct ttacatcctc gggctggggt cgccgaccca tccgttgccg       600
     cccgaggcct acgccgccta taccgaaagc tacgagtgga gaaatatcta cgggcgcgaa       660
     ctgctttact cgggaccgct cttcacccac cagctctcgc atatgtggat cgatttccgc       720
     ggcatccgcg acgccttcat gcgagaccgc gacaccgact acttccagaa tagccgccag       780
     gcgacctacg tccagcagga gtatgccatc cgcaatccga tgaactttcg cggctatggc       840
     gagcactgct ggggatttac cgcctgcgac ggaccgggat ggacgaagaa gcagctcgac       900
     ggcgtggaga gggagttctt cgactatatc gcccgcggcg cgccgttcgg accggacgac       960
     ggaaccgtct cgccatgggt ggtcgtcgca tcactgcctt tcgccccgga gatcgtcatt      1020
     ccgaccgtca gaaacttcgc acagatgaat ctgggcatga cgcatcttta cggcttcaaa      1080
     ccatccttca accagaccta tgcggtcgaa ggcaatgatg cgggttggtg ggtcagcccc      1140
     tatcatttcg gcatagacca gggaccggtc gtgctgatga tcgaaaactt caggacgggc      1200
     ctgctctgga acatcatgcg ccgcagccag ccgatcgtca ccggactgcg ccgggccggt      1260
     ttcaccggcg gctggctttg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page