(data stored in ACNUC7421 zone)

EMBL: CP001389.PE562

CP001389.PE562       Location/Qualifiers
FT   CDS_pept        complement(629237..629650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24366"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN8"
FT                   /protein_id="ACP24366.1"
FT                   /translation="MNFRMMTAAGLVLALAGCTTTTGVARNAVEKRWLGQPAGTYFAQF
FT                   GPPLSDVETGGDTVYSWKGGYKTRRIPAEYEKTADGKRGKRISAARTEYLSCAVQLTVS
FT                   SDYVIRSIRIAGDRKRPTGPSWCEEFLGGAKAE"
     atgaatttcc gcatgatgac ggcggccggc cttgtgctgg cgcttgccgg ctgcacgacg        60
     acgaccggtg tggcgagaaa cgcggtcgaa aagcgctggc tcggccagcc ggccggcacc       120
     tacttcgccc agttcggccc gccgctttcc gacgtcgaaa cgggcggcga cacggtctac       180
     agctggaagg gcggctacaa gacccgcagg atcccggccg aatacgagaa gaccgccgac       240
     ggcaagcgcg gcaagcgcat ctcggccgcc cgcaccgagt atttgagctg cgccgtgcaa       300
     ttgaccgtct cgtccgacta cgtcatccgc tcgatccgca tcgccggcga ccgcaagcgg       360
     ccgaccggcc cgagctggtg cgaagaattc ctaggcggcg cgaaggcgga gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page