(data stored in ACNUC7421 zone)

EMBL: CP001389.PE563

CP001389.PE563       Location/Qualifiers
FT   CDS_pept        complement(630053..630334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24367"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN9"
FT                   /protein_id="ACP24367.1"
FT                   /translation="MKPTVRGEDGHRCASCCRGGRDLRSYRTERSNSRSTSAKLSTSRI
FT                   SEAAKENCRRNDWELKPAGETKWQFKTPKQRFCQNFCQIFEREFLSAQ"
     atgaagccca ctgttcgagg ggaagatggg catcgttgcg ccagttgctg ccgaggagga        60
     cgagatctga gaagctaccg aacggaaaga tcgaatagca ggtcgacaag cgcaaaactg       120
     tcgacgtcgc ggatatcaga agccgcgaag gagaattgcc gcagaaacga ctgggagttg       180
     aagccggcag gcgaaacgaa gtggcagttc aagacgccaa aacagcgttt ctgtcagaat       240
     ttctgtcaga ttttcgagag ggagtttctg tcagcccaat ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page