(data stored in ACNUC7421 zone)

EMBL: CP001389.PE564

CP001389.PE564       Location/Qualifiers
FT   CDS_pept        630425..630739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24368"
FT                   /db_xref="GOA:C3MHP0"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHP0"
FT                   /protein_id="ACP24368.1"
FT                   /translation="MANFGAPAHTAALGNAAGMMIIAAGALGLANAVGDGLRAAKEARY
FT                   QARYNDALDTAISHAEQMEALARTAMELLAELEGDNKRLRAACRQRQEVIDLLKARGRV
FT                   "
     atggctaatt tcggcgcacc cgcacacacc gccgcgctcg gcaacgcggc cgggatgatg        60
     atcatcgccg ccggcgcgct tggcttggca aatgccgttg gcgacggcct ccgtgccgcg       120
     aaggaagccc gctatcaggc ccggtacaac gatgctctgg ataccgcgat ctcgcatgcc       180
     gaacagatgg aagcgctcgc gcgtacggct atggaactgc tcgctgaact tgagggcgac       240
     aacaagcggc tccgcgcggc ctgccgccag cgccaggaag ttatcgatct tctgaaggcc       300
     cgggggcgcg tatga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page