(data stored in ACNUC7421 zone)

EMBL: CP001389.PE565

CP001389.PE565       Location/Qualifiers
FT   CDS_pept        630736..630924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24369"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHP1"
FT                   /protein_id="ACP24369.1"
FT                   /translation="MKPDLTDEQWRRMKEEFGDVAVENPGMLADLLDMLTSKKSERTRT
FT                   RNEKPALSARYLASLNC"
     atgaagcctg atcttaccga cgagcaatgg cgtcggatga aagaagagtt cggtgacgta        60
     gcggttgaga acccgggcat gctcgccgat ttactcgata tgcttacctc aaaaaaaagc       120
     gaaaggacca ggacaaggaa tgagaagccc gccctctcgg cgcgctatct cgcgagtttg       180
     aattgctga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page