(data stored in ACNUC7421 zone)

EMBL: CP001389.PE566

CP001389.PE566       Location/Qualifiers
FT   CDS_pept        complement(630900..631451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24370"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHP2"
FT                   /protein_id="ACP24370.1"
FT                   /translation="MLKVIANALACLWRGALGILNWAEQFLRWPFSIIFGSGGGGMPSP
FT                   EYKPDVSSAQLLDEFDEARRRQAAVHDLDRDGISTVTKYASALPKARPTIDLGGLNKDI
FT                   RATLLTMDDNELKALSKAGIGAIRKFIAGADHGVHGVPVVRSVEISEAPKEMTEHEQVL
FT                   WKVRSRMLKSENGQQFKLAR"
     atgttgaaag taatcgcgaa tgccctcgca tgcctttgga ggggcgcgct gggaatactg        60
     aactgggcag agcaattcct gaggtggccg ttctcgataa tcttcggctc gggcggcggc       120
     ggaatgccat cccccgaata caagcccgat gtttcgtcgg cgcaattgct cgatgaattc       180
     gacgaagccc gccggagaca ggccgctgtc cacgacttgg accgcgacgg tatctcgacg       240
     gtgacgaaat acgccagcgc ccttccaaag gcacggccga ccatcgacct cggcggcttg       300
     aacaaggaca tccgtgccac gttgctgacc atggatgaca acgaactcaa ggccttgtcc       360
     aaagctggca ttggcgcgat ccggaagttt atcgcgggcg cggaccatgg cgtacatggc       420
     gtcccggttg ttcgtagcgt cgaaatttcg gaagctccga aggaaatgac agagcatgaa       480
     caggtgctct ggaaggttcg gtcacggatg ctgaagtccg agaacggtca gcaattcaaa       540
     ctcgcgagat ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page