(data stored in ACNUC7421 zone)

EMBL: CP001389.PE567

CP001389.PE567       Location/Qualifiers
FT   CDS_pept        631539..631787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24371"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHP3"
FT                   /protein_id="ACP24371.1"
FT                   /translation="MHRQKSWICGTASGAQHRAGRASSCGLGPEYLTCRLALAMNSNER
FT                   FSHFGGFVLSGKPEVEAHNTKIHPECGCNLYTNFRFR"
     atgcatcgtc agaaatcttg gatatgcggg accgcgagcg gcgctcagca ccgcgccggc        60
     agagcttcgt catgcggctt aggacccgaa tacctgacgt gccgcctggc cttggcgatg       120
     aactcgaatg agagatttag ccatttcggc ggctttgtct tatctggcaa gcccgaagta       180
     gaagcgcaca atacaaagat tcaccccgaa tgcgggtgca atctttacac gaatttcagg       240
     ttccgctaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page