(data stored in ACNUC7421 zone)

EMBL: CP001389.PE568

CP001389.PE568       Location/Qualifiers
FT   CDS_pept        631821..633266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24372"
FT                   /db_xref="GOA:C3MI24"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI24"
FT                   /protein_id="ACP24372.1"
FT                   /translation="MDIVFTAGIFARDLVLALASLLKQPPAPGLFSLFLVILLVIATLW
FT                   FWAVVRRRVGLLRRATKLVRKSRGPEEFRERFQETYDELTSWSGADAGRLADTWDEFRE
FT                   TTIESQGQTGIRNAIRPSVFFNLEEMGFSVSGWRVVPSLFVSVGLAATFLGLIAALQET
FT                   GNSLSAGGDQAAVMKALTQLLTVASAKFIMSLTGLLCSIVFTVVMRVRSSGLEQEMRTL
FT                   THAIETRMSFVSLEDLAEKQLKAIVEQRDHMQKLNHELIAAISEPLQKAAASGINHVDE
FT                   MVQSLAGSLTQGLVGAMSATSERLEAASGRLEGLAATLSGAAQEFSQAAERTAVGLDGA
FT                   ARRLELVSDNLARAGNGLAQAAVPVAESANKTAEATQQIASSSINMVESARQTMSSERE
FT                   MVVAAANSIREHIKSFETRAAAYDGQLAAAFRTFTEQISRSIGEVENHANNVHGQYTEA
FT                   LSTLQGVIENAKAFTPESARPSA"
     ttggatatcg tgttcacggc gggcatcttt gcgcgcgatc ttgtcttggc gctagcctcg        60
     ttgctgaagc aaccgccggc gcctggtctg ttcagtctct ttctcgtcat cttgttggtg       120
     atagcgaccc tttggttctg ggcggtcgtc cggagaagag tgggcttgct taggcgagca       180
     acgaagctcg tgcggaagag ccgtgggcca gaggaatttc gggagcggtt ccaggaaacc       240
     tacgacgaat tgacgtcctg gtcgggagcg gatgccggtc ggttggcgga cacctgggac       300
     gaatttcgcg agaccaccat cgaatcccaa gggcagaccg gcattcggaa cgctatccgt       360
     ccgtcagtct tctttaatct cgaggagatg ggcttcagcg tttcgggctg gcgggtcgtg       420
     ccgagcctct tcgtctcggt cgggctggcg gcaacattcc tcggtcttat cgccgccctc       480
     caggaaacgg gcaacagcct cagtgcaggc ggcgaccagg ccgcggtgat gaaggcgctt       540
     acacagcttc tgaccgttgc gtctgccaaa ttcatcatgt cgctcaccgg actgctctgt       600
     tcgatcgtct tcaccgttgt tatgcgcgtg cgcagcagcg ggcttgaaca ggaaatgcgg       660
     actcttacgc acgcgataga gacgcggatg agtttcgtca gtctcgagga ccttgccgag       720
     aagcagctga aggctatcgt cgagcagcgc gatcatatgc agaagctcaa tcacgagctc       780
     atcgctgcca tctccgaacc actgcagaaa gccgcggcat ccggcatcaa tcatgtcgac       840
     gagatggtgc aatcgctggc gggatctttg acgcaaggcc tggtcggtgc gatgtcggca       900
     acgagcgaaa ggctagaagc ggcctctggt cgcttggaag gacttgccgc cactctcagc       960
     ggggcagccc aagaattctc tcaagccgcc gagcgtacag ccgtgggtct ggatggtgcg      1020
     gcgagacggc tcgagctggt ctccgacaat ctagcgagag ccggcaatgg gcttgcccag      1080
     gctgcggtgc ccgtcgcgga gtcggcgaac aagaccgccg aagctaccca gcagatcgcc      1140
     tcctcgagca tcaacatggt ggagagcgca cgccagacca tgtcgtcgga gcgtgagatg      1200
     gtggtagcag cagccaattc cattcgagaa cacatcaaaa gcttcgagac gcgggccgcg      1260
     gcttacgacg gacagttggc cgctgccttc aggacgttta cggagcagat ctcgcgatcg      1320
     atcggcgaag tcgaaaatca cgcgaataat gtccatggcc agtatacgga agcgctttcg      1380
     accctccaag gggtgatcga gaatgcgaag gcgttcacac ctgagagcgc gaggccgtcg      1440
     gcatga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page