(data stored in ACNUC7421 zone)

EMBL: CP001389.PE569

CP001389.PE569       Location/Qualifiers
FT   CDS_pept        633263..634192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05800"
FT                   /product="OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24373"
FT                   /db_xref="GOA:C3MI25"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI25"
FT                   /protein_id="ACP24373.1"
FT                   /translation="MRGRGGARRQEEEEESVFISMADMTISFLFILMILLAFFASQFNV
FT                   SDTVPRPLYDSLKDEKDRIQRDIDAIAEIVEANGRPVVTATREMKDELERLRKLLNTPE
FT                   KANKMEVYNSAVADARKNLLTSLKSEINSRIPGVNVAVSANYDALQFAGDGLFDSGKEV
FT                   PTTVGAVRMRQIAEVLDQNLGCYSLGSRRAFTENCNPAFALIDSLQVEGHTDSVGSEVL
FT                   NMDLSAKRAASIYALMIEQKPDLVLYQNRDEQPVLSVAGFGKGRPIQQNETESGRDANR
FT                   RIDLRFIMVVPSKETDIADIRRALSGEP"
     atgaggggta ggggaggcgc gcgccgtcag gaggaagagg aagaatcggt cttcatatcg        60
     atggccgaca tgacgatcag ctttctgttc attctgatga tcctgctggc tttcttcgcg       120
     agccagttca acgtctccga taccgtgcct cgtcccctgt acgacagcct gaaagacgag       180
     aaagaccgca tccaacgtga cattgatgcg atcgctgaga ttgtcgaggc caacggtcgt       240
     ccggtggtga cggcgacccg ggagatgaag gacgagctcg aacgtctgcg caagcttctc       300
     aacactcccg agaaggcaaa caaaatggag gtctataact cggcagtcgc cgacgcccga       360
     aagaatctgc tcacaagcct gaaaagcgag atcaacagcc gcatacccgg cgtgaatgtc       420
     gcagtcagtg cgaattacga cgcgcttcaa ttcgcgggag atggactgtt cgactccggc       480
     aaagaagtgc cgactaccgt cggggcggtt cgcatgcggc agattgcgga agtcctggac       540
     caaaaccttg gctgctattc actgggttcg aggagagcct tcactgaaaa ctgcaatccg       600
     gcttttgcac tgattgactc gttgcaagtc gagggacata cggacagcgt cggtagcgag       660
     gtcctgaaca tggacctcag tgccaagcga gctgcgtcta tctacgcact tatgattgag       720
     caaaagccgg atctcgtgct ttatcagaac cgggacgagc agccggtctt gtcggtcgcc       780
     ggctttggga agggacggcc catacagcag aacgagacag agagcggcag agacgctaac       840
     cgccgtatcg accttcgctt catcatggtg gtcccgtcca aggagacaga tatcgctgac       900
     atacggcggg cgctctcggg ggagccttga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page