(data stored in ACNUC7421 zone)

EMBL: CP001389.PE57

CP001389.PE57        Location/Qualifiers
FT   CDS_pept        60873..61397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00570"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23861"
FT                   /db_xref="GOA:C3MF24"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF24"
FT                   /protein_id="ACP23861.1"
FT                   /translation="MTIKPLIILPDPILRQVSTPVETIDADIRRLADDMLETMYDAPGI
FT                   GLAAIQIGVPRRLLVLDVSKEGEEKTPLVFINPKIVKSSEERSVYEEGCLSIPDYYAEV
FT                   ERPAAIAVEYLDRDGKQQSVEADGLLATCLQHEIDHLNGVLFIDYISKLKRDMVIRKFT
FT                   KAAKTRGAKAI"
     atgacgatca agccgctcat catccttccc gatcccatcc tccgccaggt ttcgacgccc        60
     gtcgagacca tcgacgccga cattcgtcgc cttgccgacg atatgctcga aaccatgtac       120
     gacgccccgg gcatcgggct ggcggcgatc cagatcggcg tgccgaggcg cctcctcgtt       180
     ctcgacgtct cgaaagaagg cgaagagaag acgccgctgg tcttcatcaa cccgaagatc       240
     gtcaaatcct ccgaggagcg ttccgtctac gaggaaggct gcctgtcgat tccggactac       300
     tatgccgagg tcgagcgccc ggcggcgatt gccgtcgaat atctcgatcg cgacggcaag       360
     cagcaatcgg ttgaggccga cggcctgctg gccacctgct tgcagcatga gatcgaccac       420
     ctgaacggtg ttctgttcat cgattacatc tccaagctca agcgcgacat ggtgatccgc       480
     aagttcacca aggcagccaa gacgcgcggt gccaaggcga tttga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page