(data stored in ACNUC7421 zone)

EMBL: CP001389.PE570

CP001389.PE570       Location/Qualifiers
FT   CDS_pept        634194..635507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24374"
FT                   /db_xref="InterPro:IPR028943"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI26"
FT                   /protein_id="ACP24374.1"
FT                   /translation="MSLLETLRAMPHRKKFEGKSIEGLSQAVQAVFQAFPEFSRVSPAT
FT                   LEQMKAKIAAAVRDWEWGSVTVGEVGMLASAAFGRAEELDTQTLSFVRREVQATTNPVL
FT                   LDAAAEGYFAGWSRGGQLTRWLASIMQERSSHLSKRWQSVFVSIPQALDANHAPEHLAE
FT                   RMVMEPDPYRWLAGAGVASPHSGNLMQELHQAWLRTLPEIKTDAQVAHVFRWILPEGRA
FT                   RASDKMAASAIEKLLSPWLHKMPEQEYRKALLDRITDAYGDPRNKRPEFWSLVSAPCRG
FT                   VLVRWLAGASMDALLSVITKSTANHMWPPRHDFWKGLFNRGLVDEAWVALSPAAAAIAQ
FT                   DMFAKSVNAASMAAGRQTSKARKDTCLLVMRIGRYIVVEGSHDYRVHMFSDADSRAPKL
FT                   YQASYDAEALILGAGHPDTRIHDQPGHWKRWVEERVVR"
     gtgtcactcc tggaaacgct tcgtgcgatg cctcatcgca aaaagttcga gggcaagagc        60
     atcgaaggct tgagccaggc ggtgcaagct gtcttccaag cctttccgga gttcagtcgg       120
     gtctctcctg ctacgctcga gcaaatgaaa gccaagatcg cggcggccgt tcgtgactgg       180
     gaatggggga gcgtcactgt cggggaagtc gggatgctgg cgagcgctgc ctttgggcgt       240
     gccgaggaac tcgacacgca gacactcagt ttcgtgcgac gggaagtcca agccacaacc       300
     aatccggtgc ttctcgacgc ggctgctgaa gggtatttcg cgggatggtc acgcggcggt       360
     caactgacgc gatggctggc cagcatcatg caggaacggt cgtcacatct gtcgaagcgc       420
     tggcagagtg ttttcgtatc catcccgcag gcgcttgatg caaaccacgc tcccgagcac       480
     cttgccgagc gaatggtcat ggagcctgac ccgtatcgat ggctggcggg ggcaggcgtc       540
     gcctcgcctc actcgggtaa cctgatgcag gaactgcatc aggcttggtt gcggacgctc       600
     cccgagatca agactgatgc gcaggtcgcg cacgtgttcc gatggatact gcccgaaggt       660
     cgagcgaggg cgagcgataa aatggccgcc agtgccattg agaagttact gagtccgtgg       720
     ctccacaaaa tgcctgaaca ggaataccgg aaggcactcc tggatcgtat aacggatgca       780
     tacggagatc ctcgaaataa gcgcccggag ttctggtctc ttgtcagtgc gccgtgtcga       840
     ggcgtgttgg tgcgatggct tgccggggcg agtatggatg ccctgttgtc ggtaatcacg       900
     aaatcgactg ccaatcatat gtggccgcca cggcatgatt tttggaaggg gctcttcaac       960
     cgtggccttg tcgacgaggc atgggtggcg ttgtcgcccg ctgcggctgc cattgctcaa      1020
     gacatgttcg ccaaatccgt aaacgccgca agcatggcag caggtaggca gacatcgaaa      1080
     gctcgcaaag atacctgtct gctcgtaatg cgtataggtc gatacatcgt ggtcgaaggg      1140
     tcacatgact atcgtgtcca catgttctcg gacgcagata gtcgcgcgcc gaaattgtat      1200
     caggcgagct atgacgctga ggctcttatc cttggggccg gccatcccga cacaagaatt      1260
     catgatcaac ccggacattg gaagagatgg gtggaggagc gggtggtccg atga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page