(data stored in ACNUC7421 zone)

EMBL: CP001389.PE571

CP001389.PE571       Location/Qualifiers
FT   CDS_pept        635504..638722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05820"
FT                   /product="superfamily II DNA/RNA helicase and SNF2
FT                   family-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24375"
FT                   /db_xref="GOA:C3MI27"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI27"
FT                   /protein_id="ACP24375.1"
FT                   /translation="MIKFDFRADSQAAYVTVAPEKRGWLAAFRRREAVDLRALTKAERA
FT                   TALAVARLRHLDPLGELHQIAENGLVIRHPLVAQLDSNTASALGLPRLMTGYVFKAKLA
FT                   GTVGSSDFGIDWWWEKNGRTVALPLQGAFLGSAAQMMRLPSQIYSAIEQANALKERSSV
FT                   TDHWLELGKFRRLFDASDEPASRENLEGFLRNLSVVTCDSVGIAFDAEDETKFFPLPFV
FT                   GSPEPDPDRDTADVAALKGRELNEFRDGAIRRGAQPAYRVADGKFLIVDRSAAPVLDAI
FT                   ARNAKADEAGRRAFIADAGRIIQSAIERQMEDDGRITALMSPAARAERVEQETSRVWIE
FT                   TTEWVSRVLGVAKWQVTEIEGMQSSGTKWLNSSIDAELADRLSQIEDEQLAEVVEALRT
FT                   AIAEHTPLITHEVGDIPAIAEVLEALSRRLAEYLRQKPIDAPSVSLDAYLPVTHDNFWE
FT                   VDFKAAVRPRGNEAEFKFPEAVRTALQPHQLTSLKWQVAAWQAGIPGVLNADEQGLGKT
FT                   LQTLSFVAWLRAEMDAGAVPHRPFLVVAPTSLLLNWEAEIDRHLSAQALGIPVRLYGSH
FT                   LAEFKKEGLSGQDIREGEALLDLDKIRSLENGAPVVITTYQTLANFAISLMDLQCAVAI
FT                   FDEIQFVKNPVTMRAKAAKSLNADFRIGLTGTPIENATKDLWALMDQLFPGALGALAQF
FT                   KRVFGLPTEENMSALHHALFSGQHERPPLALRRLKTDAAPGLPTKVRILHPREMSEPQM
FT                   LRYDEARRKGGMMLALLHHIRRISLHPGLLEGETTEEFSASAARVDAAMDILRHIKSKG
FT                   ERALVFVENRDVQAWFAEVVRLEFNLDTVMIINGDTTIDARKEITDRFQRHLTNDGGFD
FT                   VLVLGPRAAGTGLTLTAANHVIHLSRWWNPAVEEQCNDRTHRIGQTKPVTVHIPLAVHT
FT                   RLGAGSFDCLLQRLMKRKRTIADRVLWPAEATESETRMLYDAVVEASDVEVGSEALELD
FT                   GVLEGRTDLTAEMLDGNAIRIRPRRGGASIVVSSGRTVPSSSIRSDTDAAVVSMQVHGV
FT                   GKEMPVPHSRLTTGTLWPEFVLPE"
     atgatcaagt ttgattttcg agccgatagc caagccgcgt acgtcaccgt tgcgccggaa        60
     aaaagaggat ggcttgccgc attccggcgc cgtgaggcgg tcgatctgcg ggctctgacg       120
     aaggcggagc gcgccacagc gttggccgtt gctcgcctga ggcatctgga tccattgggt       180
     gagctgcatc agatagccga gaatggtctc gttatccgcc atccgctggt ggcgcagctg       240
     gactcgaaca ccgcttcagc tcttgggctt ccccgtttga tgaccggtta tgttttcaag       300
     gcgaaacttg ccgggaccgt tggaagctct gacttcggca ttgattggtg gtgggaaaag       360
     aacggtcgga cggttgcctt gccgcttcag ggagcttttc tcggctccgc tgcgcagatg       420
     atgcgactgc caagccagat ctattccgcc atcgagcagg cgaatgccct caaggagcga       480
     tcatcggtta ccgatcattg gctggaattg gggaagttcc gccgcctgtt tgacgcgtcg       540
     gatgaaccag catcgcggga gaacctggaa ggattcctgc gcaacctttc ggtggttacc       600
     tgtgactcgg tcggtatcgc gttcgatgcc gaagatgaga cgaagttctt cccgcttcct       660
     ttcgtcggtt cgcctgaacc ggatcccgac agagacaccg ccgatgtcgc cgccctcaaa       720
     ggccgcgagc tgaatgaatt tcgtgacggg gccattcgac gaggagctca gccggcctac       780
     cgggttgccg acggcaagtt cctgatagtt gatcgctccg ccgcacctgt ccttgatgcc       840
     atcgcaagga atgcaaaggc agatgaagcg gggcgacgcg catttattgc agacgctggc       900
     cggataatac aatcggcgat cgagcgtcag atggaagacg acgggcgcat aaccgccctc       960
     atgagcccgg ctgccagggc agaaagggtc gagcaggaaa cttctcgagt gtggatcgag      1020
     accaccgaat gggtgtctcg cgtcctcggc gtcgccaaat ggcaggtgac ggaaatcgaa      1080
     gggatgcaga gttcagggac gaaatggttg aattcctcca tcgatgctga gctggccgat      1140
     cgtctttctc agatcgagga tgaacagcta gcagaagtcg tcgaggccct ccgtaccgca      1200
     atcgccgagc acacaccttt gatcacgcac gaggttggcg acatacctgc gatcgccgaa      1260
     gtccttgaag cgctgtcgag acggttggct gagtacttga ggcagaagcc aatcgatgca      1320
     ccttctgttt cgctggatgc atacctgccg gtgacgcacg acaacttctg ggaggtcgac      1380
     ttcaaggccg cggtacgccc gcggggaaac gaggcagagt tcaagtttcc cgaagccgtc      1440
     aggaccgcac tgcagcccca tcagctgacc tcgctcaaat ggcaggttgc ggcttggcag      1500
     gcaggtattc ccggcgttct gaacgccgat gagcaagggt tgggaaaaac gcttcagacg      1560
     ctgtcattcg tggcatggct cagggctgag atggatgccg gcgccgttcc gcaccgacct      1620
     ttccttgttg tggctccaac gtcgctgctt ctgaactggg aagcggagat agatcgacac      1680
     ctctccgctc aggctctcgg aattccggtg cggttgtatg gctcccattt ggccgagttc      1740
     aaaaaggaag gtctctcggg gcaagacatc cgcgagggcg aagcattgct ggacctggac      1800
     aagatccggt ctctcgagaa tggcgcgccc gttgtgataa ccacctacca gacgctcgcg      1860
     aacttcgcga tcagcctgat ggatctccaa tgcgcggtgg cgattttcga tgagatccag      1920
     ttcgtcaaaa acccggtgac aatgcgagcc aaggcggcaa aatcgctcaa tgcggatttc      1980
     cggatcggac tgaccgggac accgatcgag aacgcgacca aagacctctg ggcgttgatg      2040
     gaccaactct tccctggggc gctcggtgca ttggcgcagt tcaaacgggt cttcggtctc      2100
     cccacggaag agaatatgtc ggcccttcac cacgctttgt tctcagggca gcatgagcgt      2160
     ccgcccttag cgctcaggcg attgaagacc gatgccgccc ctgggctgcc cacaaaggtg      2220
     cggatcttgc atcctcgcga gatgtccgaa cctcagatgc tgagatacga cgaggctcgc      2280
     cgcaagggcg gcatgatgct cgcgctcctt catcacatcc ggcggatatc gttgcatccc      2340
     ggtctgctgg aaggcgaaac cacagaggag ttcagcgctt cggcggcacg cgtcgacgcg      2400
     gcgatggaca ttctgcgtca tatcaaatca aagggcgagc gtgctcttgt attcgtcgag      2460
     aaccgagatg tccaagcctg gttcgccgaa gttgtgcggt tggaattcaa tctcgacact      2520
     gtgatgatca tcaacggcga cacgaccatc gacgcccgta aggaaatcac cgaccgcttc      2580
     caacgacacc taacgaacga cggtgggttc gacgtcctgg tgcttggacc aagagccgca      2640
     ggcaccgggc tgacactcac cgcagccaat catgtcattc acctgagccg ttggtggaac      2700
     cccgcagtcg aagagcagtg caatgaccgc acccaccgca tcggtcaaac gaagcctgtt      2760
     acggttcata ttccgctcgc agttcacaca cggctgggcg cgggctcttt cgactgtctt      2820
     ctgcagcgcc tcatgaagcg gaaacgtacg atcgcagatc gcgttctctg gccagccgag      2880
     gccaccgaga gcgagactag gatgctctac gacgcggtcg tcgaagcttc ggatgtagag      2940
     gttgggagcg aagcgctgga gttggatggc gtactcgagg gcagaaccga cctgaccgcc      3000
     gagatgctgg acgggaatgc aatccgcata cgtcctcggc gcggcggagc gtcaattgtc      3060
     gtctcgagtg gccggactgt cccatcgagt tccatccgtt ccgataccga tgccgccgtt      3120
     gtatcgatgc aggtgcatgg ggttggcaag gagatgccgg tcccgcattc cagactgacg      3180
     accggtacgc tttggccaga gttcgtcctg cctgagtaa                             3219
//

If you have problems or comments...

PBIL Back to PBIL home page