(data stored in ACNUC7421 zone)

EMBL: CP001389.PE572

CP001389.PE572       Location/Qualifiers
FT   CDS_pept        complement(638801..639709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05830"
FT                   /product="superfamily I DNA and RNA helicases and
FT                   helicasesubunits-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24376"
FT                   /db_xref="GOA:C3MI28"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI28"
FT                   /protein_id="ACP24376.1"
FT                   /translation="MVETTGPRKNALEHEGAALGRLHARSNNRKALAYWLGFLKGILAS
FT                   NKVETAEYAPLAVEAQNFLSLLHDPDALELIEDLRIWKNEPNEIYEIVENIVAMRSRDF
FT                   VVESEKDEINELYGFCAGIACDNRICLEEIESLLTKLESYPRVQGDRRVLNLKAAAQRS
FT                   IADGRITAEESDDICTWITHLVGDSATDTGIATFGNVGVLEGALEDHNDIVFDQRMFVL
FT                   TGKFTLGPRKAIHGMIADRGGDFKSSVCRNTNYLCVAAEASRDWRHSHEGLKIMKAIEL
FT                   RAEGRGPELVHEGILTRALSR"
     atggttgaaa caacgggtcc gcggaaaaat gcactcgaac acgaaggagc ggcgctcggt        60
     cgacttcacg cgagatcgaa caatagaaag gccctcgcat actggctggg ttttctaaaa       120
     gggatccttg caagcaataa agtcgagacc gccgagtacg ccccgcttgc agtggaagct       180
     cagaacttcc tcagtctcct tcacgatccc gatgcgcttg agctcattga ggacctccgc       240
     atatggaaga acgagccgaa tgaaatatac gagatcgtcg agaatattgt agccatgcgc       300
     tcgcgagatt tcgtcgtcga gagcgaaaag gatgagatca acgagctcta tggattttgc       360
     gccggtattg cctgtgacaa tcgcatctgc ctcgaagaga tagagagctt gctcacaaag       420
     ctggaaagct atccacgggt acagggagat cggcgggtac tcaacctcaa ggcagccgcg       480
     caacggtcaa tcgccgacgg gaggatcacg gccgaggaat cggacgacat ttgcacctgg       540
     atcactcatc tggtcgggga cagcgcaact gacacaggga ttgcgacctt cgggaatgtc       600
     ggcgtcctcg agggtgcgct tgaagaccac aacgacatag tcttcgacca acggatgttc       660
     gtactgaccg ggaagttcac ccttggtccc aggaaggcga ttcatgggat gattgccgat       720
     cgaggcggcg acttcaaaag cagtgtctgc agaaacacaa attatctctg cgtggccgca       780
     gaagcatccc gagattggcg gcatagccac gaaggcttaa agattatgaa ggccattgaa       840
     ctacgagcag aaggccgcgg cccagagctc gtacatgagg gaatcctgac gcgagcgctg       900
     tctcgatag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page