(data stored in ACNUC7421 zone)

EMBL: CP001389.PE573

CP001389.PE573       Location/Qualifiers
FT   CDS_pept        complement(639745..640989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24377"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI29"
FT                   /protein_id="ACP24377.1"
FT                   /translation="MVGILPSWRPDIGGTARRKSRIGRPYMICTLIKEGKKVGITANSH
FT                   KVIRNLIDKVIEVARESDAKVQAGQKISSKTENTDDIHFFTDNGEAVTAITSGEVQVLG
FT                   GTAFFWAREDAAGTIDVLFVDEAAQMSLANVLSVSQAGPTLVLLGDPQQLEQPTQGSHP
FT                   DGTDVSALDHLLCGHKTILPEQGLFLEVTWRLHPDITAFNSELFYEGKLQSEADCHRQS
FT                   TTSTGPFTGTGLRYVPVAHFGNQSRSLEEAAAVERIVETLLGSGVHWTDRKGVSRPLAL
FT                   EDIIIIAPYNAHVFEIQKRLPEAHVGTVDKFQGQEAPIAIYSMATSTHADAPRGMEFLY
FT                   SSNRLNVAISRAKCMAILVASPDLFETECKTPRQMQLANAFCRYLEMARLVELQATPSA
FT                   SSTLSESGVRCVSDF"
     ttggtgggaa tacttccgtc ttggcgacct gacatcggag gaactgctcg acgaaaaagc        60
     aggattgggc ggccctatat gatctgcaca ttgatcaaag aaggcaaaaa ggtcgggatc       120
     acggccaaca gccacaaggt catccgcaac ctgatcgaca aggtgattga agtcgcgagg       180
     gaaagcgacg ccaaagttca ggcaggccag aagatctctt cgaaaacaga aaacaccgac       240
     gatatccatt tcttcacgga caatggcgaa gccgtcaccg cgatcacgtc cggggaagtg       300
     caggtactgg gcggaacggc gttcttctgg gcccgcgagg acgcggctgg caccatcgac       360
     gttctgttcg tcgacgaggc tgcgcaaatg tcgcttgcga atgtgctgtc cgtctcgcag       420
     gctgggccga cactggtact tcttggggat ccgcagcaac tggagcaacc aacccagggc       480
     tctcatcccg acggtacgga cgtgtctgca ctcgatcacc ttctttgcgg ccacaagacg       540
     atcctgccgg agcaaggcct cttcctggaa gtaacctggc ggctgcaccc agacatcacc       600
     gcgttcaact ccgagctatt ctacgagggc aagctccagt cggaggccga ctgtcacagg       660
     caatccacga cgtcgaccgg gccattcacc ggaacaggtc tgcgttacgt ccccgttgcc       720
     cattttggca accagtcgcg atccctcgaa gaagccgccg cggtagagcg gatcgtcgaa       780
     acactgcttg gctccggggt gcactggacc gatcggaaag gtgtgtcccg accgctggcg       840
     ttagaggaca tcatcatcat cgccccctac aacgcacatg tgttcgagat ccagaaacgc       900
     cttccggaag cacacgttgg cacggtcgac aaattccagg ggcaagaggc tcctatcgcc       960
     atctactcga tggccacatc cacacatgcg gacgcaccgc gcggaatgga gttcctgtac      1020
     agctcgaacc gtctgaacgt ggcgatcagc cgcgcgaaat gcatggccat cctcgtcgcc      1080
     tcaccggacc tgttcgagac ggaatgcaag acgcctcgcc agatgcaact ggcgaatgcc      1140
     ttctgcagat atcttgaaat ggcgaggctt gtcgaattgc aggcgacgcc ttcggcctct      1200
     tcgacacttt cggaaagcgg tgtgcggtgt gtctcggact tttga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page