(data stored in ACNUC7421 zone)

EMBL: CP001389.PE574

CP001389.PE574       Location/Qualifiers
FT   CDS_pept        complement(640908..642362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24378"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI30"
FT                   /protein_id="ACP24378.1"
FT                   /translation="MTHAENDRSAALKIRGMTYPLTLQLSLYADLLRVMQGIAPENVYV
FT                   VVPWANFVPQTFRVADYGAFFRKARRAAEEATGAGSGEHYPEPTEHCDICRWADACQTR
FT                   WRKDDHLSLVANISKSQIAELRAHAVSTTKALAQLPSPFPWKPDRGSAASFEKTRAQAH
FT                   IQVSAREAGELLYDLLEVVPDTGLCRLPEPSLGDIFFDIEGDPFIGEHGLEYLFGYHYR
FT                   NEAGDYVRLANWAFDRNTEKAIFERFMDFVTSRREQFPDLHIYHYAPYEPATLKRLMGR
FT                   YATRESEVDRLLRGNVLVDLYTVVRNAVRASVESYSIKKLEAFYGFVRATPLREANVAL
FT                   TALQVALQVNDVVSVSDEIKAVVATYNDDDCRSTEALRDWLEQLRTEIIASGTAVERPA
FT                   PEKDEPSEDLSESEARVAALIGALTYNVPVDVAERTAAEHGKWILAYCLDWHRREAKSN
FT                   WWEYFRLGDLTSEELLDEKAGLGGPI"
     atgactcatg cagagaatga ccgttcagcg gccttaaaga tacgtgggat gacctacccg        60
     cttacgctcc agctgagttt gtacgccgat ctcctccggg tgatgcaggg tatcgcgcct       120
     gagaacgtct acgttgtggt gccttgggcg aattttgttc cgcagacatt ccgcgtcgcg       180
     gactatggtg ctttcttccg aaaggcacgg agggcggcgg aggaggccac cggcgccggt       240
     tcgggcgaac actatccgga acccactgaa cattgcgaca tttgccgatg ggccgatgca       300
     tgccagactc gctggcggaa ggacgaccat ctgtcccttg tcgcgaacat ctcaaaatcg       360
     cagatcgcgg agctacgcgc acacgctgta tcaacgacaa aggcgttggc acagctccct       420
     tccccgtttc cgtggaagcc ggaccgtggc tccgccgcga gtttcgagaa gaccagggca       480
     caagcgcaca tccaagtgag cgcgcgcgaa gcgggcgagc tgctttacga tctgctcgaa       540
     gtcgtaccgg acaccggcct ttgtcgcctg cccgagccat cgttaggtga catttttttc       600
     gacatcgaag gcgatccatt catcggagag cacgggctcg aatacctttt cggataccac       660
     taccgcaacg aggccggaga ctacgtgcgg ttagccaact gggcgttcga ccgtaacacg       720
     gagaaggcca tcttcgagcg gttcatggat tttgtcactt cgcgtcgcga gcagttcccg       780
     gacctccaca tctatcacta tgcgccatat gagccggcga cgttgaagcg cctaatgggg       840
     cgctatgcca cgcgcgaaag cgaagtcgac cgactgttgc gcggcaacgt cctcgtcgat       900
     ctttacactg tggtgcgcaa tgccgtccga gcgagtgtcg agagctattc gatcaagaag       960
     ttagaagcgt tttacgggtt cgtccgcgcc acgcctttgc gggaggcgaa cgttgcgctc      1020
     acggcgctgc aggtggcgct gcaggtcaac gacgttgtct cggtctccga cgagatcaag      1080
     gcggtcgtgg ccacttacaa cgatgacgat tgccgctcca cggaagcctt gcgcgactgg      1140
     ctggaacaat tgcgcacgga gatcattgct tccggcaccg ctgtcgagcg ccccgcgccc      1200
     gaaaaggatg aaccgagcga agacttgtcg gagagcgagg cacgcgttgc ggcgctcatt      1260
     ggggccctca cctacaacgt ccctgtcgac gtagccgaaa ggaccgcagc cgaacacgga      1320
     aagtggattt tggcctattg cctggattgg catcgacgtg aggcaaagtc gaattggtgg      1380
     gaatacttcc gtcttggcga cctgacatcg gaggaactgc tcgacgaaaa agcaggattg      1440
     ggcggcccta tatga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page