(data stored in ACNUC7421 zone)

EMBL: CP001389.PE575

CP001389.PE575       Location/Qualifiers
FT   CDS_pept        642375..642761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05860"
FT                   /product="putative transposase number 1 for insertion
FT                   sequence NGRIS-11a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24379"
FT                   /db_xref="GOA:C3MI31"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI31"
FT                   /protein_id="ACP24379.1"
FT                   /translation="MSDSVNHHRTFEVLTAEPVRSRRKPRHWSDEEKAQLVAEALSPGA
FT                   NVSAIARSQGLDPSQLYAWRRKALSSGMVAPLTEGPSAPVKFTRFEAVSSSMVEIVVGD
FT                   VVVRAGGDVDADHLAKILRVVRTA"
     atgagcgaca gtgtgaatca tcatcgaaca ttcgaggtcc tgacggccga gccggtgcgg        60
     tctcgacgca agccacgtca ttggtcggac gaagagaagg cgcagcttgt cgctgaggcg       120
     ctctcgccgg gagccaatgt gtcggcgatt gcccggtctc agggattgga cccgtcgcag       180
     ctctatgcgt ggcgtcgtaa ggcgctttcg tcaggaatgg tcgcgccatt gacggaggga       240
     ccgagcgcgc cagtcaagtt cacgcgcttt gaggcggtga gcagttcaat ggtggaaatc       300
     gtcgtgggcg atgtcgtggt gcgcgccggc ggcgatgtcg atgccgatca cttggccaag       360
     attctccggg tggtccgcac ggcatga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page