(data stored in ACNUC7421 zone)

EMBL: CP001389.PE576

CP001389.PE576       Location/Qualifiers
FT   CDS_pept        642758..643102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05870"
FT                   /product="putative transposase number 2 for insertion
FT                   sequence NGRIS-11a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24380"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI32"
FT                   /protein_id="ACP24380.1"
FT                   /translation="MIASGVVVYVSCQPVDFRKGAASLMALVRDGGLDPFNGSLYVFRS
FT                   KRADRVRIVWWDGSGVCLYSKTLEEQGFCWPGISAARMRLDHPQLMALLAGLDWKKIRP
FT                   AKIRRPLLTG"
     atgatcgctt ccggtgtggt ggtttacgtg tcgtgccagc cggtcgactt ccgcaagggc        60
     gcagcgtctt tgatggcgct ggtccgagat ggcggtctcg accctttcaa tggctcgctt       120
     tacgtgttcc ggtcgaagcg ggcggaccgg gttcgcattg tctggtggga tggctcaggc       180
     gtctgcctct attcgaaaac cctggaagag caaggcttct gctggccggg catatcggcg       240
     gcgcggatgc gtctggacca tccgcaactg atggcgcttc tggctgggct cgattggaaa       300
     aagatccgcc cggccaagat caggcggccg ttgttgacgg gctga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page