(data stored in ACNUC7421 zone)

EMBL: CP001389.PE577

CP001389.PE577       Location/Qualifiers
FT   CDS_pept        643160..644797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05880"
FT                   /product="putative transposase number 3 for insertion
FT                   sequence NGRIS-11a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24381"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI33"
FT                   /protein_id="ACP24381.1"
FT                   /translation="MCSIASMDLPVSDLPDDVDALKAMILAMAREQAANETRLAAAAAE
FT                   VERLKAVEESANERIANLTAILKVLQRTQHGKRSERLRLAVNDEQVSFAFEEVETGLAA
FT                   IQSELDRAAGDKPKRAPRPRKGFAAHLERIEEVIEPEIPADCAGLEKVLIGEDRSERLD
FT                   VVPPKFRVIVTRRPKYAFRGRDGVAQALAPAHLIESGLPTERLLAYIAVSKYADGLPLY
FT                   RQEAIYLRDGVEVSRSLMAQWMGHLGFELQMVADYILERVKEGERVFADETSLPTLAPG
FT                   SGKTTKAWLWAYARDDRPYGGTSPPMVAYRFEDSRGGDCVARHLAGFSGILQVDGYSAY
FT                   TSLAKTRAKTGSNEPIQLAGCWAHLRRKFYDLHISGVSQAATESIVAMTELWKLEDEVR
FT                   GKNAESRAARRHEESATIVASLFELWEKELGKVSGKSKTAEAIRYAFTRREALECFLTD
FT                   GRIEIDSNIVERAIRPQTITRKNSLFAGSEGGGRTWATVATLLQTAKMNSVDPLDWLSQ
FT                   TLTRIAQGWPASEIEALMPWNFKPDVIG"
     ttgtgctcta ttgcctccat ggatttgccc gtttccgatc ttcccgacga cgtcgatgcg        60
     ctgaaagcga tgatccttgc gatggcgcgc gagcaggctg cgaacgagac ccggcttgcg       120
     gccgcggcgg cagaggtcga gcggctgaag gccgtcgaag agagcgccaa cgagcggatc       180
     gccaacctca cggcgatcct gaaagttttg cagcgcacgc aacatggcaa gcgatccgag       240
     cggctgcgcc tggccgtcaa tgacgaacag gtttcctttg cgttcgagga ggtcgaaacc       300
     ggccttgcgg caatccagag cgaactcgac cgcgcggccg gggacaagcc gaagcgtgcg       360
     ccgcgtccgc gcaagggctt tgccgctcat ctcgaacgca tcgaggaggt tatcgagccg       420
     gaaatcccgg ccgactgcgc ggggctggaa aaggttctga tcggcgagga tcgctccgag       480
     cggctggacg tggtgccgcc gaagttccgg gtgatcgtga cgcgccgccc caaatacgct       540
     ttccggggcc gcgatggcgt agcccaggcc ctggcaccgg cacaccttat cgaaagcggc       600
     ctgccgacgg agcggctgct cgcctatatc gccgtgtcga aatacgccga tggccttccg       660
     ctttaccggc aggaggcgat ctatctgcgc gatggcgtcg aggtcagccg gtcgttgatg       720
     gcgcagtgga tggggcatct gggcttcgaa ttgcagatgg tcgccgatta tatcctcgag       780
     cgggtcaagg agggcgaaag ggtcttcgcc gacgagacga gcttgcccac gcttgccccc       840
     ggttccggga aaaccaccaa ggcctggctg tgggcctacg cacgcgatga tcgaccctac       900
     ggtggaacca gtccgccgat ggttgcctat cgctttgagg acagccgggg cggcgattgc       960
     gtggcgcgtc atctcgccgg attcagcggc atcctgcagg ttgacggcta ctcagcctat      1020
     accagcctgg ccaagacgcg ggccaaaacc ggcagcaatg aacccatcca gctcgcaggc      1080
     tgctgggccc atctgcggcg caagttttac gatctgcaca tcagcggggt ctctcaggcc      1140
     gcaacggaat cgatcgtcgc catgaccgag ttgtggaagc tcgaggacga agtccgcggc      1200
     aagaatgccg agagccgcgc ggcgcgacgc catgaagaat ccgcgaccat cgtcgccagc      1260
     ctcttcgagc tttgggaaaa ggagcttggc aaggtctcgg gaaaatccaa aaccgccgag      1320
     gcgatccgct atgcgttcac ccggcgagag gcactggaat gctttctgac ggacggtcgc      1380
     atcgagatcg actccaacat cgtcgaacgg gcgatcagac cccaaacgat tacgagaaag      1440
     aacagtctat tcgccggcag cgagggcggt ggacgaacct gggcgacggt ggccacctta      1500
     ttgcaaacgg ccaaaatgaa cagcgtcgat ccgctcgact ggctctcgca gaccttgacc      1560
     cgcattgctc aaggctggcc agcatccgaa atcgaagcgc tcatgccctg gaacttcaag      1620
     cctgacgtta tcggctga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page