(data stored in ACNUC7421 zone)

EMBL: CP001389.PE578

CP001389.PE578       Location/Qualifiers
FT   CDS_pept        644960..645283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24382"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI34"
FT                   /protein_id="ACP24382.1"
FT                   /translation="MFPGTHRFQGCANGFVIDFYAWDRNCLQSPSLEMVEEFGFVLQPT
FT                   FLEDLQQGIPSSGFGQRALGDLEIKIRQMAAVEMANQIMRAEDDLSADSLHVSTVSGIM
FT                   RAV"
     ttgtttcccg gaacgcatcg cttccaaggt tgcgccaacg gtttcgtcat tgacttctat        60
     gcctgggatc gcaattgcct ccagtccccg tcccttgaga tggtcgagga attcggcttc       120
     gtgcttcaac ccacgttcct ggaggatctc cagcaaggga tcccatcgag cgggtttggc       180
     caacgcgcct tgggcgacct ggagatcaag atccgtcaga tggcggcagt tgagatggcc       240
     aaccagatca tgcgcgccga ggatgatttg agtgccgatt cgctgcatgt ttcaactgta       300
     agcggtatta tgcgcgctgt ctaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page