(data stored in ACNUC7421 zone)

EMBL: CP001389.PE580

CP001389.PE580       Location/Qualifiers
FT   CDS_pept        complement(645933..647006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24384"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI36"
FT                   /protein_id="ACP24384.1"
FT                   /translation="MPQLWYKCATSQTDCILAVMATDSHDLSTESELLTSLPDIAVSVQ
FT                   GFGSQDTAQALGNGVIHLLHEVGRFIDISSLDGVTIAVDYDAALRDLDRGIEGLRPEER
FT                   TKDGILTGVGKAILVKRADDVKTHLVFAAEALSCLALKEADSGLFYLALALIAHECAHV
FT                   EEHARRNRQFPGTLLNEESLGFVPACLRQFSEAFWCEYAVCRASANFAPNEGDGFREAL
FT                   KLRLEPARREAREAIKAYRTHGDALRVFNEVGLAVIEPLRMASYLFGHLDGFSGDLTDV
FT                   TIELPTNDQAFVAGITELVSQLRDLWDRRDHWESHDDMLVLGETAFDVLRLCGVDVQPS
FT                   ANGQAHIAVPITLDTIP"
     atgccgcagc tttggtataa gtgtgcgacc agccagacgg actgtatatt ggctgtcatg        60
     gccactgatt cgcacgatct aagcacagag agtgaactgc ttacgtcgct accggacatc       120
     gcggtgagcg ttcaaggttt tggcagccaa gatactgccc aagcactagg aaacggcgtg       180
     atccacctcc ttcatgaggt cggtagattt attgatatca gctcgttgga cggggtcact       240
     attgcagtcg actatgacgc agcactgcgc gatcttgatc gcggtattga gggcctgcgc       300
     ccggaagagc gcactaaaga cggcattttg accggcgtcg gcaaagccat tcttgttaag       360
     cgcgctgacg acgtgaagac gcatctcgtg ttcgccgcag aagcgctgtc ctgtcttgcc       420
     ttaaaggagg cagactctgg gcttttttac ttggcgctgg cgctgatcgc gcatgaatgc       480
     gcgcatgtag aggaacacgc tcggcgcaat aggcagtttc ccggcacgct gctgaatgaa       540
     gagtctctgg gatttgtccc agcatgtctc cgccagtttt ccgaagcttt ctggtgcgaa       600
     tacgcggttt gccgtgcatc cgccaacttt gctcccaacg agggcgacgg ttttagagaa       660
     gcgctcaaac ttcggctgga accagcacgt agggaagcgc gcgaggccat caaagcctac       720
     agaactcacg gcgacgcctt gcgggtcttc aacgaggttg gattagccgt catcgagccg       780
     ctgcgcatgg catcttacct tttcggtcac ctggatggat tctccggaga cttaacggac       840
     gtgaccattg aattgccaac caacgatcag gcattcgttg ctggcatcac tgagctcgtc       900
     tcgcaactca gggatctgtg ggacaggcgc gaccattggg agagccacga cgatatgctg       960
     gtccttggtg aaacggcatt cgacgtgctt cgcttgtgtg gagttgacgt tcagccgagt      1020
     gcgaatggtc aagcccacat cgcggtcccg atcacactgg atacaattcc ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page