(data stored in ACNUC7421 zone)

EMBL: CP001389.PE581

CP001389.PE581       Location/Qualifiers
FT   CDS_pept        647440..647865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24385"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI37"
FT                   /protein_id="ACP24385.1"
FT                   /translation="MFVLPLAGIVIGGAYGWATVPPEDTISASFPICASGARTTCVVDG
FT                   DTFWLDGIKYRISDIDTPEISEPKCAWERELGQRAKYRLQSLLNGGSFGLKAGLRDADK
FT                   YGRKLREVYRGGRSLGAQLIDEGLAHRWLGFKQSWCG"
     gtgtttgtgt tgcctctcgc tggcatcgtg ataggtggag cctacggctg ggcgaccgtg        60
     ccgccggaag acaccatttc ggcatccttc cccatatgcg catcgggcgc gcggacaacg       120
     tgcgtcgtgg atggtgatac gttctggctc gacggcatca agtaccggat ctcggacatc       180
     gatacgccgg agatcagcga gcctaaatgt gcctgggagc gggaactcgg acagcgcgcc       240
     aagtatcggc tgcagagcct gttgaatggc ggttccttcg gcctcaaggc cggactgcgc       300
     gatgcggaca aatacggtcg gaagctgcgc gaggtctacc gaggcggccg atcgctcgga       360
     gctcaactca ttgatgaggg actggcgcac cgctggcttg gcttcaaaca gtcgtggtgc       420
     ggataa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page